Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : Z4WWZ1

dbSWEET id: dbswt_1980

Accession:   Z4WWZ1

Uniprot status:   Unreviewed

Organism:   Atopobium

Kingdom:   Bacteria

Taxonomy back to top


Bacteria ⇒ Actinobacteria ⇒ Coriobacteriia ⇒ Coriobacteriales ⇒ Atopobiaceae ⇒ Atopobium.

Sequence Information back to top


Sequence length:   94

Substrate Binding Site:   CNCN           CVV:   364       CHI:   -2

Selectivity Filter:   SNSN           CVV:   338       CHI:   -8.6

Fasta sequence:

>tr|Z4WWZ1|Z4WWZ1_9ACTN|Unreviewed|Atopobium|94
MTEKHALSFDENFFNKLGQFGSILSVMMYVSYIPQITNNLAGNKGSFIQPLVAMINCTVW
FVYGAFKKERDVPIMIANAPGILFGLVTALTALL

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   18     Model end:   94

Inward Open:

Template:   4X5M.pdb

Model structure:  Z4WWZ1_inward.pdb    Alignment file: Z4WWZ1_inw.pir

Procheck score ⇒ Ramachandran plot: 92.2% favored    6.2% allowed    .8% week    .8% disallowed

Outward Open:

Template:   4X5N.pdb

Model structure:  Z4WWZ1_outward.pdb    Alignment file: Z4WWZ1_out.pir

Procheck score ⇒ Ramachandran plot: 94.5% favored    4.7% allowed    .0% week    .8% disallowed

Occluded:

Template:   4QNC.pdb      4RNG.pdb

Model structure:  Z4WWZ1_occluded.pdb    Alignment file: Z4WWZ1_occ.pir

Procheck score ⇒ Ramachandran plot: 93.8% favored    4.7% allowed    .0% week    1.6% disallowed

Gene Informationback to top


Not Available

Gene Ontologyback to top


GO:0016021 - integral component of membrane

Family Classificationback to top


Pfam:   PF03083: MtN3_slv 

Interpro:   IPR004316: SWEET_sugar_transpr. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur