Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : X8K4A9

dbSWEET id: dbswt_1976

Accession:   X8K4A9

Uniprot status:   Unreviewed

Organism:   Eubacterium sulci

Kingdom:   Bacteria

Taxonomy back to top


Bacteria ⇒ Firmicutes ⇒ Clostridia ⇒ Clostridiales ⇒ Clostridiales Family XIII. Incertae Sedis.

Sequence Information back to top


Sequence length:   86

Substrate Binding Site:   CNCN           CVV:   364       CHI:   -2

Selectivity Filter:   TSTS           CVV:   332       CHI:   -3

Fasta sequence:

>tr|X8K4A9|X8K4A9_9FIRM|Unreviewed|Eubacterium sulci|86
MKKKINMIVGSIGAFIGVFVFITYIPQIIANLNGVKGQPWQPLTAAFSCLIWVIYGWTKE
PKKDYILIIPNAAGVVLGFLTFITAI

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   10     Model end:   87

Inward Open:

Template:   4X5M.pdb

Model structure:  X8K4A9_inward.pdb    Alignment file: X8K4A9_inw.pir

Procheck score ⇒ Ramachandran plot: 91.3% favored    7.9% allowed    .0% week    .8% disallowed

Outward Open:

Template:   4X5N.pdb

Model structure:  X8K4A9_outward.pdb    Alignment file: X8K4A9_out.pir

Procheck score ⇒ Ramachandran plot: 93.7% favored    6.3% allowed    .0% week    .0% disallowed

Occluded:

Template:   4QNC.pdb      4RNG.pdb

Model structure:  X8K4A9_occluded.pdb    Alignment file: X8K4A9_occ.pir

Procheck score ⇒ Ramachandran plot: 88.1% favored    10.3% allowed    .0% week    1.6% disallowed

Gene Informationback to top


Not Available

Gene Ontologyback to top


GO:0016021 - integral component of membrane

Family Classificationback to top


Pfam:   PF03083: MtN3_slv 

Interpro:   IPR004316: SWEET_sugar_transpr. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur