| Basic Information |
| Taxanomy |
| Sequence Information |
| Modeled Structures |
| Gene Information |
| Gene Ontology |
| Family Classification |
Details : X2H9Q8
dbSWEET id: dbswt_1969
Accession: X2H9Q8
Uniprot status: Unreviewed
Organism: Gilliamella apicola
Kingdom: Bacteria
Taxonomy back to top
Bacteria ⇒ Proteobacteria ⇒ Gammaproteobacteria ⇒ Orbales ⇒ Orbaceae ⇒ Gilliamella.
Sequence Information back to top
Sequence length: 87
Substrate Binding Site: CNCN CVV: 364 CHI: -2
Selectivity Filter: SNSN CVV: 338 CHI: -8.6
Fasta sequence:
>tr|X2H9Q8|X2H9Q8_9GAMM|Unreviewed|Gilliamella apicola|87
MKLSEKAFHYLGIIATAASLCMYISYIPQIIDNLHGFKSNPTQPLAAAINCLLWVFYGLL
RENKDWPIAIANSPGVIFGFIAFLTAL
Snake diagram with key positions labelled

Modeled Structuresback to top
Model start: 12 Model end: 88 Inward Open: Template: 4X5M.pdb Model structure: X2H9Q8_inward.pdb Alignment file: X2H9Q8_inw.pir Procheck score ⇒ Ramachandran plot: 91.5% favored 6.9% allowed .8% week .8% disallowed Outward Open: Template: 4X5N.pdb Model structure: X2H9Q8_outward.pdb Alignment file: X2H9Q8_out.pir Procheck score ⇒ Ramachandran plot: 90.8% favored 7.7% allowed 1.5% week .0% disallowed Occluded: Model structure: X2H9Q8_occluded.pdb Alignment file: X2H9Q8_occ.pir Procheck score ⇒ Ramachandran plot: 92.3% favored 4.6% allowed 3.1% week .0% disallowed
Family Classificationback to top
Pfam: PF03083: MtN3_slv
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA