| Basic Information |
| Taxanomy |
| Sequence Information |
| Modeled Structures |
| Gene Information |
| Gene Ontology |
| Family Classification |
Details : W9SLX1
dbSWEET id: dbswt_279
Accession: W9SLX1
Uniprot status: Unreviewed
Organism: Morus notabilis
Kingdom: Plantae
Taxonomy back to top
Eukaryota ⇒ Viridiplantae ⇒ Streptophyta ⇒ Embryophyta ⇒ Tracheophyta ⇒ Spermatophyta ⇒ Magnoliophyta ⇒ eudicotyledons ⇒ Gunneridae ⇒ Pentapetalae ⇒ rosids ⇒ fabids ⇒ Rosales ⇒ Moraceae ⇒ Morus.
Sequence Information back to top
Sequence length: 254
Substrate Binding Site: ANWN CVV: 422 CHI: -6.1
Selectivity Filter: VSVC CVV: 369 CHI: 10.1
Fasta sequence:
>tr|W9SLX1|W9SLX1_9ROSA|Unreviewed|Morus_notabilis|254
MVLGNIVSFLVYLAPLPTFYRIFRKKSTEGFQAIPYSVALFSAMLTLYYGILKGLPNGVM
IITINSIGCAIESIYLIVFLIYAPGKVRIYTIKLLVLFNMGAYGLILLSTSFVGKISQRV
TVVGWICAVFSVCVFAAPLSIIRLVIKTRSVEYMPFALSFCLTLCAVMWFFYGLLVNDFF
IASPNILGFLFGIAQMILYLVFKNSKKEVLPEFKLQEMPPNVAAQANAVQEATVINGNNI
PSSERNNNDVTMIV
Snake diagram with key positions labelled

Modeled Structuresback to top
Model start: 1 Model end: 204
Alignment file: W9SLX1.pir
Inward Open:
Template: 5CTG.pdb
Model structure: W9SLX1_inward.pdb
Procheck score ⇒ Ramachandran plot: 93.3% favored 5.6% allowed .6% week .6% disallowed
Outward Open:
Template: 5CTG_outward.pdb
Model structure: W9SLX1_outward.pdb
Procheck score ⇒ Ramachandran plot: 92.7% favored 6.1% allowed 1.1% week .0% disallowed
Occluded:
Template: 5CTG_occluded.pdb
Model structure: W9SLX1_occluded.pdb
Procheck score ⇒ Ramachandran plot: 92.2% favored 6.7% allowed 1.1% week .0% disallowed
Gene Informationback to top
Gene ID: 21403367 Total Exons: 5 Coding Exons: 5
The diagram below shows the position of Exon-junctions in the protein structure ( Loops and transmembrane helices ).
If more than 1 exon translates a single secondary-structure , only the final exon is represented in figure.
Point on the red bars to view exon number





Gene Ontologyback to top
GO:0016021 - integral component of membrane
GO:0005886 - plasma membrane
GO:0008643 - carbohydrate transport
Family Classificationback to top
Pfam: PF03083: MtN3_slv.
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA