Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : W9S739

dbSWEET id: dbswt_816

Accession:   W9S739

Uniprot status:   Unreviewed

Organism:   Morus notabilis

Kingdom:   Plantae

Taxonomy back to top


Eukaryota ⇒ Viridiplantae ⇒ Streptophyta ⇒ Embryophyta ⇒ Tracheophyta ⇒ Spermatophyta ⇒ Magnoliophyta ⇒ eudicotyledons ⇒ Gunneridae ⇒ Pentapetalae ⇒ rosids ⇒ fabids ⇒ Rosales ⇒ Moraceae ⇒ Morus.

Sequence Information back to top


Sequence length:   262

Substrate Binding Site:   CSWN           CVV:   418       CHI:   -2.7

Selectivity Filter:   FNMN           CVV:   451       CHI:   -2.3

Fasta sequence:

>tr|W9S739|W9S739_9ROSA|Unreviewed|Morus_notabilis|262
MVSTEAARTAVGIIGNIICLFFYLSPVPTFVRIWKKRSVEQYIAFPYLAALINCLAWTIY
GLPMVQPGSIPVLTISAAGVAVESVYVVLFFIFSDKRKRLKVLLILLVGLSFNALLGCLV
LTLVHTHKKRSKIVGIICASFSVLMNFSPLAVMKLVITTKSVEFMPFYLSFASFVNNAAW
VIYALLRFDSFVLIPNGLGLLFGLTQLILHAVYSKSTKELMAARKGPKGKEVDLSDDVVA
EEPPKKIIGIITPENGPDSDNH

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   1     Model end:   215

Alignment file: W9S739.pir

Inward Open:

Template:   5CTG.pdb

Model structure:  W9S739_inward.pdb

Procheck score ⇒ Ramachandran plot: 91.7% favored    6.8% allowed    1.6% week    .0% disallowed

Outward Open:

Template:   5CTG_outward.pdb

Model structure:  W9S739_outward.pdb

Procheck score ⇒ Ramachandran plot: 92.2% favored    7.3% allowed    .5% week    .0% disallowed

Occluded:

Template:   5CTG_occluded.pdb

Model structure:  W9S739_occluded.pdb

Procheck score ⇒ Ramachandran plot: 92.7% favored    5.7% allowed    .5% week    1.0% disallowed

Gene Informationback to top


Gene ID:   21391218     Total Exons:   5     Coding Exons:   5

The diagram below shows the position of Exon-junctions in the protein structure ( Loops and transmembrane helices ).

If more than 1 exon translates a single secondary-structure , only the final exon is represented in figure.
Point on the red bars to view exon number

Gene Ontologyback to top


GO:0016021 - integral component of membrane

GO:0005886 - plasma membrane

GO:0008643 - carbohydrate transport

Family Classificationback to top


Pfam:   PF03083: MtN3_slv. 

Interpro:   IPR004316: SWEET_sugar_transpr. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur