| Basic Information |
| Taxanomy |
| Sequence Information |
| Modeled Structures |
| Gene Information |
| Gene Ontology |
| Family Classification |
Details : W9S0E8
dbSWEET id: dbswt_467
Accession: W9S0E8
Uniprot status: Unreviewed
Organism: Morus notabilis
Kingdom: Plantae
Taxonomy back to top
Eukaryota ⇒ Viridiplantae ⇒ Streptophyta ⇒ Embryophyta ⇒ Tracheophyta ⇒ Spermatophyta ⇒ Magnoliophyta ⇒ eudicotyledons ⇒ Gunneridae ⇒ Pentapetalae ⇒ rosids ⇒ fabids ⇒ Rosales ⇒ Moraceae ⇒ Morus.
Sequence Information back to top
Sequence length: 357
Substrate Binding Site: ANWN CVV: 422 CHI: -6.1
Selectivity Filter: VNAN CVV: 364 CHI: -1
Fasta sequence:
>tr|W9S0E8|W9S0E8_9ROSA|Unreviewed|Morus_notabilis|357
MAGSLIIFFGMLDLKPAYTGNIMSGLVYISPANVFWRICKRGSTEEFESIPYVSKLLNAY
FWIYYGLIKPDSLLVATVNMFGAVVEIIFLTIFLLFAPPRMKIRTAILVVVLDVVFPAAA
ILCTHFLLHGDTRIDVAGLLCVAFSMVAYASPLSAIKTLLLTKSVEYMPFLLSFILFLNG
GVWTAYALLAKDLFVGLPNGTGFFLGTLQLILYAIYWKPKSSRRIVDDLEHQDKHEPLIK
SSEQLQQDTHTRTTVSSLPCDPVVSVDATTGPVSARSTCRGRAGEIVRENYNTLIKFDHA
SSLPCDPVVSVDATTGPVSARSTCRGRAGEIVRENYNTLIKFDHAVNPDKSQDQIWS
Snake diagram with key positions labelled

Modeled Structuresback to top
Model start: 6 Model end: 218
Alignment file: W9S0E8.pir
Inward Open:
Template: 5CTG.pdb
Model structure: W9S0E8_inward.pdb
Procheck score ⇒ Ramachandran plot: 95.7% favored 3.8% allowed .0% week .5% disallowed
Outward Open:
Template: 5CTG_outward.pdb
Model structure: W9S0E8_outward.pdb
Procheck score ⇒ Ramachandran plot: 94.6% favored 3.8% allowed .5% week 1.1% disallowed
Occluded:
Template: 5CTG_occluded.pdb
Model structure: W9S0E8_occluded.pdb
Procheck score ⇒ Ramachandran plot: 93.0% favored 5.9% allowed .5% week .5% disallowed
Gene Informationback to top
Gene ID: 21386604 Total Exons: 8 Coding Exons: 8
The diagram below shows the position of Exon-junctions in the protein structure ( Loops and transmembrane helices ).
If more than 1 exon translates a single secondary-structure , only the final exon is represented in figure.
Point on the red bars to view exon number







Gene Ontologyback to top
GO:0016021 - integral component of membrane
GO:0008643 - carbohydrate transport
Family Classificationback to top
Pfam: PF03083: MtN3_slv.
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA