Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : W9S0E8

dbSWEET id: dbswt_467

Accession:   W9S0E8

Uniprot status:   Unreviewed

Organism:   Morus notabilis

Kingdom:   Plantae

Taxonomy back to top


Eukaryota ⇒ Viridiplantae ⇒ Streptophyta ⇒ Embryophyta ⇒ Tracheophyta ⇒ Spermatophyta ⇒ Magnoliophyta ⇒ eudicotyledons ⇒ Gunneridae ⇒ Pentapetalae ⇒ rosids ⇒ fabids ⇒ Rosales ⇒ Moraceae ⇒ Morus.

Sequence Information back to top


Sequence length:   357

Substrate Binding Site:   ANWN           CVV:   422       CHI:   -6.1

Selectivity Filter:   VNAN           CVV:   364       CHI:   -1

Fasta sequence:

>tr|W9S0E8|W9S0E8_9ROSA|Unreviewed|Morus_notabilis|357
MAGSLIIFFGMLDLKPAYTGNIMSGLVYISPANVFWRICKRGSTEEFESIPYVSKLLNAY
FWIYYGLIKPDSLLVATVNMFGAVVEIIFLTIFLLFAPPRMKIRTAILVVVLDVVFPAAA
ILCTHFLLHGDTRIDVAGLLCVAFSMVAYASPLSAIKTLLLTKSVEYMPFLLSFILFLNG
GVWTAYALLAKDLFVGLPNGTGFFLGTLQLILYAIYWKPKSSRRIVDDLEHQDKHEPLIK
SSEQLQQDTHTRTTVSSLPCDPVVSVDATTGPVSARSTCRGRAGEIVRENYNTLIKFDHA
SSLPCDPVVSVDATTGPVSARSTCRGRAGEIVRENYNTLIKFDHAVNPDKSQDQIWS

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   6     Model end:   218

Alignment file: W9S0E8.pir

Inward Open:

Template:   5CTG.pdb

Model structure:  W9S0E8_inward.pdb

Procheck score ⇒ Ramachandran plot: 95.7% favored    3.8% allowed    .0% week    .5% disallowed

Outward Open:

Template:   5CTG_outward.pdb

Model structure:  W9S0E8_outward.pdb

Procheck score ⇒ Ramachandran plot: 94.6% favored    3.8% allowed    .5% week    1.1% disallowed

Occluded:

Template:   5CTG_occluded.pdb

Model structure:  W9S0E8_occluded.pdb

Procheck score ⇒ Ramachandran plot: 93.0% favored    5.9% allowed    .5% week    .5% disallowed

Gene Informationback to top


Gene ID:   21386604     Total Exons:   8     Coding Exons:   8

The diagram below shows the position of Exon-junctions in the protein structure ( Loops and transmembrane helices ).

If more than 1 exon translates a single secondary-structure , only the final exon is represented in figure.
Point on the red bars to view exon number

Gene Ontologyback to top


GO:0016021 - integral component of membrane

GO:0008643 - carbohydrate transport

Family Classificationback to top


Pfam:   PF03083: MtN3_slv. 

Interpro:   IPR004316: SWEET_sugar_transpr. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur