Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : W9RBF5

dbSWEET id: dbswt_449

Accession:   W9RBF5

Uniprot status:   Unreviewed

Organism:   Morus notabilis

Kingdom:   Plantae

Taxonomy back to top


Eukaryota ⇒ Viridiplantae ⇒ Streptophyta ⇒ Embryophyta ⇒ Tracheophyta ⇒ Spermatophyta ⇒ Magnoliophyta ⇒ eudicotyledons ⇒ Gunneridae ⇒ Pentapetalae ⇒ rosids ⇒ fabids ⇒ Rosales ⇒ Moraceae ⇒ Morus.

Sequence Information back to top


Sequence length:   311

Substrate Binding Site:   TNWN           CVV:   448       CHI:   -8.6

Selectivity Filter:   VSMN           CVV:   398       CHI:   1.8

Fasta sequence:

>tr|W9RBF5|W9RBF5_9ROSA|Unreviewed|Morus_notabilis|311
MAASLSLIIGIIDKIYTSFAGNIISILVFTSPIKTFWVVVKKKSTENYQGIPYITTLLST
SLWTFYGLLNPQGLLILTVNGAGAFLQLIYVTFFLIYAPRDKKVQTAKLIAMLNVGFPGS
IIALTLLAVREEIKLTFVGILCAALTIGMYASPLSAMGMVIKMKSVEYMPFLFSFFLFLN
GGIWSIYAALVKDFFVGIPNAIGFVLGSSQLIIYAIYKNKSKKSTKEEGSDVTLVKRAVE
MQANRGDDDDDEDNLKNKSLHKGRSLPQPIVNQLYTMPTKLMKTLSLRSQELNSVWDFGE
DLENGEKNIHP

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   7     Model end:   219

Alignment file: W9RBF5.pir

Inward Open:

Template:   5CTG.pdb

Model structure:  W9RBF5_inward.pdb

Procheck score ⇒ Ramachandran plot: 94.6% favored    4.3% allowed    .5% week    .5% disallowed

Outward Open:

Template:   5CTG_outward.pdb

Model structure:  W9RBF5_outward.pdb

Procheck score ⇒ Ramachandran plot: 91.9% favored    7.0% allowed    .5% week    .5% disallowed

Occluded:

Template:   5CTG_occluded.pdb

Model structure:  W9RBF5_occluded.pdb

Procheck score ⇒ Ramachandran plot: 93.0% favored    4.3% allowed    1.6% week    1.1% disallowed

Gene Informationback to top


Gene ID:   21386597     Total Exons:   6     Coding Exons:   6

The diagram below shows the position of Exon-junctions in the protein structure ( Loops and transmembrane helices ).

If more than 1 exon translates a single secondary-structure , only the final exon is represented in figure.
Point on the red bars to view exon number

Gene Ontologyback to top


GO:0016021 - integral component of membrane

GO:0005886 - plasma membrane

GO:0008643 - carbohydrate transport

Family Classificationback to top


Pfam:   PF03083: MtN3_slv. 

Interpro:   IPR004316: SWEET_sugar_transpr. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur