Basic Information |
Taxanomy |
Sequence Information |
Modeled Structures |
Gene Information |
Gene Ontology |
Family Classification |
Details : W9RBF5
dbSWEET id: dbswt_449
Accession: W9RBF5
Uniprot status: Unreviewed
Organism: Morus notabilis
Kingdom: Plantae
Taxonomy back to top
Eukaryota ⇒ Viridiplantae ⇒ Streptophyta ⇒ Embryophyta ⇒ Tracheophyta ⇒ Spermatophyta ⇒ Magnoliophyta ⇒ eudicotyledons ⇒ Gunneridae ⇒ Pentapetalae ⇒ rosids ⇒ fabids ⇒ Rosales ⇒ Moraceae ⇒ Morus.
Sequence Information back to top
Sequence length: 311
Substrate Binding Site: TNWN CVV: 448 CHI: -8.6
Selectivity Filter: VSMN CVV: 398 CHI: 1.8
Fasta sequence:
>tr|W9RBF5|W9RBF5_9ROSA|Unreviewed|Morus_notabilis|311
MAASLSLIIGIIDKIYTSFAGNIISILVFTSPIKTFWVVVKKKSTENYQGIPYITTLLST
SLWTFYGLLNPQGLLILTVNGAGAFLQLIYVTFFLIYAPRDKKVQTAKLIAMLNVGFPGS
IIALTLLAVREEIKLTFVGILCAALTIGMYASPLSAMGMVIKMKSVEYMPFLFSFFLFLN
GGIWSIYAALVKDFFVGIPNAIGFVLGSSQLIIYAIYKNKSKKSTKEEGSDVTLVKRAVE
MQANRGDDDDDEDNLKNKSLHKGRSLPQPIVNQLYTMPTKLMKTLSLRSQELNSVWDFGE
DLENGEKNIHP
Snake diagram with key positions labelled
Modeled Structuresback to top
Model start: 7 Model end: 219
Alignment file: W9RBF5.pir
Inward Open:
Template: 5CTG.pdb
Model structure: W9RBF5_inward.pdb
Procheck score ⇒ Ramachandran plot: 94.6% favored 4.3% allowed .5% week .5% disallowed
Outward Open:
Template: 5CTG_outward.pdb
Model structure: W9RBF5_outward.pdb
Procheck score ⇒ Ramachandran plot: 91.9% favored 7.0% allowed .5% week .5% disallowed
Occluded:
Template: 5CTG_occluded.pdb
Model structure: W9RBF5_occluded.pdb
Procheck score ⇒ Ramachandran plot: 93.0% favored 4.3% allowed 1.6% week 1.1% disallowed
Gene Informationback to top
Gene ID: 21386597 Total Exons: 6 Coding Exons: 6
The diagram below shows the position of Exon-junctions in the protein structure ( Loops and transmembrane helices ).
If more than 1 exon translates a single secondary-structure , only the final exon is represented in figure.
Point on the red bars to view exon number
Gene Ontologyback to top
GO:0016021 - integral component of membrane
GO:0005886 - plasma membrane
GO:0008643 - carbohydrate transport
Family Classificationback to top
Pfam: PF03083: MtN3_slv.
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA