Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : W9R8M8

dbSWEET id: dbswt_622

Accession:   W9R8M8

Uniprot status:   Unreviewed

Organism:   Morus notabilis

Kingdom:   Plantae

Taxonomy back to top


Eukaryota ⇒ Viridiplantae ⇒ Streptophyta ⇒ Embryophyta ⇒ Tracheophyta ⇒ Spermatophyta ⇒ Magnoliophyta ⇒ eudicotyledons ⇒ Gunneridae ⇒ Pentapetalae ⇒ rosids ⇒ fabids ⇒ Rosales ⇒ Moraceae ⇒ Morus.

Sequence Information back to top


Sequence length:   243

Substrate Binding Site:   CNFN           CVV:   413       CHI:   -1.7

Selectivity Filter:   LNMM           CVV:   468       CHI:   4.1

Fasta sequence:

>tr|W9R8M8|W9R8M8_9ROSA|Unreviewed|Morus_notabilis|243
MTTALSSVYAVCSDAAGVAVCSDAAGVAGNLLAFGLFLSPIPTFRRIIRNHSTEQFSGLP
YIYSFLNCLICLWYGTPIISPGVILVATVNSIGAVFQFLYIIIFIFYAERVKKLKMTGLL
IAIFALFAIIVFVSVKVLDSGVRQAFVGYLSVASLISMFASPLFIIKLVIKTRSVEFMPF
YLSLSTFLMSLSFFAYGMLKYDGFIYVPNGIGSILGLVQLALYYYFSGTSSEDSREPLID
MYA

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   15     Model end:   228

Alignment file: W9R8M8.pir

Inward Open:

Template:   5CTG.pdb

Model structure:  W9R8M8_inward.pdb

Procheck score ⇒ Ramachandran plot: 95.7% favored    3.7% allowed    .5% week    .0% disallowed

Outward Open:

Template:   5CTG_outward.pdb

Model structure:  W9R8M8_outward.pdb

Procheck score ⇒ Ramachandran plot: 94.7% favored    4.8% allowed    .5% week    .0% disallowed

Occluded:

Template:   5CTG_occluded.pdb

Model structure:  W9R8M8_occluded.pdb

Procheck score ⇒ Ramachandran plot: 93.0% favored    6.4% allowed    .0% week    .5% disallowed

Gene Informationback to top


Gene ID:   21398709     Total Exons:   7     Coding Exons:   7

The diagram below shows the position of Exon-junctions in the protein structure ( Loops and transmembrane helices ).

If more than 1 exon translates a single secondary-structure , only the final exon is represented in figure.
Point on the red bars to view exon number

Gene Ontologyback to top


GO:0016021 - integral component of membrane

GO:0008643 - carbohydrate transport

Family Classificationback to top


Pfam:   PF03083: MtN3_slv. 

Interpro:   IPR004316: SWEET_sugar_transpr. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur