| Basic Information |
| Taxanomy |
| Sequence Information |
| Modeled Structures |
| Gene Information |
| Gene Ontology |
| Family Classification |
Details : W9R8M8
dbSWEET id: dbswt_622
Accession: W9R8M8
Uniprot status: Unreviewed
Organism: Morus notabilis
Kingdom: Plantae
Taxonomy back to top
Eukaryota ⇒ Viridiplantae ⇒ Streptophyta ⇒ Embryophyta ⇒ Tracheophyta ⇒ Spermatophyta ⇒ Magnoliophyta ⇒ eudicotyledons ⇒ Gunneridae ⇒ Pentapetalae ⇒ rosids ⇒ fabids ⇒ Rosales ⇒ Moraceae ⇒ Morus.
Sequence Information back to top
Sequence length: 243
Substrate Binding Site: CNFN CVV: 413 CHI: -1.7
Selectivity Filter: LNMM CVV: 468 CHI: 4.1
Fasta sequence:
>tr|W9R8M8|W9R8M8_9ROSA|Unreviewed|Morus_notabilis|243
MTTALSSVYAVCSDAAGVAVCSDAAGVAGNLLAFGLFLSPIPTFRRIIRNHSTEQFSGLP
YIYSFLNCLICLWYGTPIISPGVILVATVNSIGAVFQFLYIIIFIFYAERVKKLKMTGLL
IAIFALFAIIVFVSVKVLDSGVRQAFVGYLSVASLISMFASPLFIIKLVIKTRSVEFMPF
YLSLSTFLMSLSFFAYGMLKYDGFIYVPNGIGSILGLVQLALYYYFSGTSSEDSREPLID
MYA
Snake diagram with key positions labelled

Modeled Structuresback to top
Model start: 15 Model end: 228
Alignment file: W9R8M8.pir
Inward Open:
Template: 5CTG.pdb
Model structure: W9R8M8_inward.pdb
Procheck score ⇒ Ramachandran plot: 95.7% favored 3.7% allowed .5% week .0% disallowed
Outward Open:
Template: 5CTG_outward.pdb
Model structure: W9R8M8_outward.pdb
Procheck score ⇒ Ramachandran plot: 94.7% favored 4.8% allowed .5% week .0% disallowed
Occluded:
Template: 5CTG_occluded.pdb
Model structure: W9R8M8_occluded.pdb
Procheck score ⇒ Ramachandran plot: 93.0% favored 6.4% allowed .0% week .5% disallowed
Gene Informationback to top
Gene ID: 21398709 Total Exons: 7 Coding Exons: 7
The diagram below shows the position of Exon-junctions in the protein structure ( Loops and transmembrane helices ).
If more than 1 exon translates a single secondary-structure , only the final exon is represented in figure.
Point on the red bars to view exon number







Gene Ontologyback to top
GO:0016021 - integral component of membrane
GO:0008643 - carbohydrate transport
Family Classificationback to top
Pfam: PF03083: MtN3_slv.
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA