Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : W9R2X9

dbSWEET id: dbswt_158

Accession:   W9R2X9

Uniprot status:   Unreviewed

Organism:   Morus notabilis

Kingdom:   Plantae

Taxonomy back to top


Eukaryota ⇒ Viridiplantae ⇒ Streptophyta ⇒ Embryophyta ⇒ Tracheophyta ⇒ Spermatophyta ⇒ Magnoliophyta ⇒ eudicotyledons ⇒ Gunneridae ⇒ Pentapetalae ⇒ rosids ⇒ fabids ⇒ Rosales ⇒ Moraceae ⇒ Morus.

Sequence Information back to top


Sequence length:   295

Substrate Binding Site:   SNWN           CVV:   428       CHI:   -8.7

Selectivity Filter:   VSVG           CVV:   331       CHI:   7.2

Fasta sequence:

>tr|W9R2X9|W9R2X9_9ROSA|Unreviewed|Morus_notabilis|295
MASHHYLTLAFGLLGNIVSFMVFLAPIPTFHKIYKKKSAEGFQSLPYVIALLSSMLWIYY
ALLKKDALLLITINSVGCVIETVYIALFLFYAPKKTRIETVKLLLMLNVVGYGLMLVLTI
FLAEGEKRLQAVGWICLAFNLSVFAAPLCIMRQVIRTKSVEFMPFPLSFFLTLGAVMWFF
YGLLLKDYNIAFPNVLGFFFGIAQMALYIVYKNAKKTILLEPKLQELSEHVIDVVKISAL
VCPTELNPVFIQTNDTGSTGNDKITDHENENHQVKAKIEETKEANKNKDGSADRV

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   1     Model end:   213

Alignment file: W9R2X9.pir

Inward Open:

Template:   5CTG.pdb

Model structure:  W9R2X9_inward.pdb

Procheck score ⇒ Ramachandran plot: 93.2% favored    5.3% allowed    1.1% week    .5% disallowed

Outward Open:

Template:   5CTG_outward.pdb

Model structure:  W9R2X9_outward.pdb

Procheck score ⇒ Ramachandran plot: 93.7% favored    4.2% allowed    .5% week    1.6% disallowed

Occluded:

Template:   5CTG_occluded.pdb

Model structure:  W9R2X9_occluded.pdb

Procheck score ⇒ Ramachandran plot: 93.7% favored    3.2% allowed    1.1% week    2.1% disallowed

Gene Informationback to top


Gene ID:   21392177     Total Exons:   6     Coding Exons:   6

The diagram below shows the position of Exon-junctions in the protein structure ( Loops and transmembrane helices ).

If more than 1 exon translates a single secondary-structure , only the final exon is represented in figure.
Point on the red bars to view exon number

Gene Ontologyback to top


GO:0016021 - integral component of membrane

GO:0005886 - plasma membrane

GO:0008643 - carbohydrate transport

Family Classificationback to top


Pfam:   PF03083: MtN3_slv. 

Interpro:   IPR018179: SWEET10-like. IPR004316: SWEET_sugar_transpr. 

Panther:  PTHR10791:SF22

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur