| Basic Information |
| Taxanomy |
| Sequence Information |
| Modeled Structures |
| Gene Information |
| Gene Ontology |
| Family Classification |
Details : W9R2X9
dbSWEET id: dbswt_158
Accession: W9R2X9
Uniprot status: Unreviewed
Organism: Morus notabilis
Kingdom: Plantae
Taxonomy back to top
Eukaryota ⇒ Viridiplantae ⇒ Streptophyta ⇒ Embryophyta ⇒ Tracheophyta ⇒ Spermatophyta ⇒ Magnoliophyta ⇒ eudicotyledons ⇒ Gunneridae ⇒ Pentapetalae ⇒ rosids ⇒ fabids ⇒ Rosales ⇒ Moraceae ⇒ Morus.
Sequence Information back to top
Sequence length: 295
Substrate Binding Site: SNWN CVV: 428 CHI: -8.7
Selectivity Filter: VSVG CVV: 331 CHI: 7.2
Fasta sequence:
>tr|W9R2X9|W9R2X9_9ROSA|Unreviewed|Morus_notabilis|295
MASHHYLTLAFGLLGNIVSFMVFLAPIPTFHKIYKKKSAEGFQSLPYVIALLSSMLWIYY
ALLKKDALLLITINSVGCVIETVYIALFLFYAPKKTRIETVKLLLMLNVVGYGLMLVLTI
FLAEGEKRLQAVGWICLAFNLSVFAAPLCIMRQVIRTKSVEFMPFPLSFFLTLGAVMWFF
YGLLLKDYNIAFPNVLGFFFGIAQMALYIVYKNAKKTILLEPKLQELSEHVIDVVKISAL
VCPTELNPVFIQTNDTGSTGNDKITDHENENHQVKAKIEETKEANKNKDGSADRV
Snake diagram with key positions labelled

Modeled Structuresback to top
Model start: 1 Model end: 213
Alignment file: W9R2X9.pir
Inward Open:
Template: 5CTG.pdb
Model structure: W9R2X9_inward.pdb
Procheck score ⇒ Ramachandran plot: 93.2% favored 5.3% allowed 1.1% week .5% disallowed
Outward Open:
Template: 5CTG_outward.pdb
Model structure: W9R2X9_outward.pdb
Procheck score ⇒ Ramachandran plot: 93.7% favored 4.2% allowed .5% week 1.6% disallowed
Occluded:
Template: 5CTG_occluded.pdb
Model structure: W9R2X9_occluded.pdb
Procheck score ⇒ Ramachandran plot: 93.7% favored 3.2% allowed 1.1% week 2.1% disallowed
Gene Informationback to top
Gene ID: 21392177 Total Exons: 6 Coding Exons: 6
The diagram below shows the position of Exon-junctions in the protein structure ( Loops and transmembrane helices ).
If more than 1 exon translates a single secondary-structure , only the final exon is represented in figure.
Point on the red bars to view exon number






Gene Ontologyback to top
GO:0016021 - integral component of membrane
GO:0005886 - plasma membrane
GO:0008643 - carbohydrate transport
Family Classificationback to top
Pfam: PF03083: MtN3_slv.
Interpro: IPR018179: SWEET10-like. IPR004316: SWEET_sugar_transpr.
Panther: PTHR10791:SF22