Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : W8R1X1

dbSWEET id: dbswt_161

Accession:   W8R1X1

Uniprot status:   Unreviewed

Organism:   Medicago truncatula

Kingdom:   Plantae

Taxonomy back to top


Eukaryota ⇒ Viridiplantae ⇒ Streptophyta ⇒ Embryophyta ⇒ Tracheophyta ⇒ Spermatophyta ⇒ Magnoliophyta ⇒ eudicotyledons ⇒ Gunneridae ⇒ Pentapetalae ⇒ rosids ⇒ fabids ⇒ Fabales ⇒ Fabaceae ⇒ Papilionoideae ⇒ Trifolieae ⇒ Medicago.

Sequence Information back to top


Sequence length:   270

Substrate Binding Site:   ANWN           CVV:   422       CHI:   -6.1

Selectivity Filter:   TSVN           CVV:   367       CHI:   -0.8

Fasta sequence:

>tr|W8R1X1|W8R1X1_MEDTR|Unreviewed|Medicago_truncatula|270
MALFYSEYWAFVFGVIGNVISCMTFLAPLPTFYRIYKKKSTEGFQSVPYVTALFSAMLWI
YYAHVKNKATLLLLTINIYGFGIEAIYIIIFLLYASNKARLSTIKLLFLTVCGYGTMVIL
TTYLTKGSKRLSIIGWICMVFNICVFASPLFILKQVIKTKSVAFMPLNLSFFLTLNAIVW
FFYGLLIDDFYIAIPNTLGFVFGIVQMVIYLIYKDAIPLESTKLQKPNDHVLNICEDVPN
GALQPGPNQVVKSGAPAVAVIGGEDPNNGK

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   3     Model end:   215

Alignment file: W8R1X1.pir

Inward Open:

Template:   5CTG.pdb

Model structure:  W8R1X1_inward.pdb

Procheck score ⇒ Ramachandran plot: 94.3% favored    3.6% allowed    1.6% week    .5% disallowed

Outward Open:

Template:   5CTG_outward.pdb

Model structure:  W8R1X1_outward.pdb

Procheck score ⇒ Ramachandran plot: 94.3% favored    5.2% allowed    .5% week    .0% disallowed

Occluded:

Template:   5CTG_occluded.pdb

Model structure:  W8R1X1_occluded.pdb

Procheck score ⇒ Ramachandran plot: 93.2% favored    5.2% allowed    1.0% week    .5% disallowed

Gene Informationback to top


Not Available

Gene Ontologyback to top


GO:0016021 - integral component of membrane

GO:0005886 - plasma membrane

GO:0008643 - carbohydrate transport

Family Classificationback to top


Pfam:   PF03083: MtN3_slv. 

Interpro:   IPR018179: SWEET10-like. IPR004316: SWEET_sugar_transpr. 

Panther:  PTHR10791:SF22

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur