Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : W8AR93

dbSWEET id: dbswt_1259

Accession:   W8AR93

Uniprot status:   Unreviewed

Organism:   Ceratitis capitata

Kingdom:   Metazoa

Taxonomy back to top


Eukaryota ⇒ Metazoa ⇒ Ecdysozoa ⇒ Arthropoda ⇒ Hexapoda ⇒ Insecta ⇒ Pterygota ⇒ Neoptera ⇒ Endopterygota ⇒ Diptera ⇒ Brachycera ⇒ Muscomorpha ⇒ Tephritoidea ⇒ Tephritidae ⇒ Ceratitis ⇒ Ceratitis.

Sequence Information back to top


Sequence length:   253

Substrate Binding Site:   SNWN           CVV:   428       CHI:   -8.7

Selectivity Filter:   QLLV           CVV:   467       CHI:   8.3

Fasta sequence:

>tr|W8AR93|W8AR93_CERCA|Unreviewed|Ceratitis_capitata|253
MDALGDLLAPYSELIAKVAGTITTLQFLSGVLLLNDIRKRGRSDGYPPDPFLGGVVLSIL
TLKMGTLMGDSATILVNIVGFAISVVFLSAFYWFASNDFKMKIWSKIGIAGAFTVACLTY
AAYEDPHKIEFRFGMLITGILVFLVGSPLLSLNKIIEKKSTEGMPFPIILTGTLVTASWA
LYAISIKNPMMAYQNLFLLALGSIQLSLFAIYPNSSPLPESSVQHTPSTLEHKKSENKTS
IPSTTSVDSKKKN

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   5     Model end:   214

Alignment file: W8AR93.pir

Inward Open:

Template:   5CTG.pdb

Model structure:  W8AR93_inward.pdb

Procheck score ⇒ Ramachandran plot: 90.6% favored    6.6% allowed    2.2% week    .6% disallowed

Outward Open:

Template:   5CTG_outward.pdb

Model structure:  W8AR93_outward.pdb

Procheck score ⇒ Ramachandran plot: 93.4% favored    6.1% allowed    .6% week    .0% disallowed

Occluded:

Template:   5CTG_occluded.pdb

Model structure:  W8AR93_occluded.pdb

Procheck score ⇒ Ramachandran plot: 92.3% favored    6.6% allowed    1.1% week    .0% disallowed

Gene Informationback to top


Gene ID:   101463208     Total Exons:   3     Coding Exons:   3

The diagram below shows the position of Exon-junctions in the protein structure ( Loops and transmembrane helices ).

If more than 1 exon translates a single secondary-structure , only the final exon is represented in figure.
Point on the red bars to view exon number

Gene Ontologyback to top


GO:0016021 - integral component of membrane

GO:0005886 - plasma membrane

GO:0008643 - carbohydrate transport

Family Classificationback to top


Pfam:   PF03083: MtN3_slv 

Interpro:   IPR018178: SWEET_insect. IPR004316: SWEET_sugar_transpr. 

Panther:  PTHR10791:SF5

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur