Basic Information |
Taxanomy |
Sequence Information |
Modeled Structures |
Gene Information |
Gene Ontology |
Family Classification |
Details : W8AR93
dbSWEET id: dbswt_1259
Accession: W8AR93
Uniprot status: Unreviewed
Organism: Ceratitis capitata
Kingdom: Metazoa
Taxonomy back to top
Eukaryota ⇒ Metazoa ⇒ Ecdysozoa ⇒ Arthropoda ⇒ Hexapoda ⇒ Insecta ⇒ Pterygota ⇒ Neoptera ⇒ Endopterygota ⇒ Diptera ⇒ Brachycera ⇒ Muscomorpha ⇒ Tephritoidea ⇒ Tephritidae ⇒ Ceratitis ⇒ Ceratitis.
Sequence Information back to top
Sequence length: 253
Substrate Binding Site: SNWN CVV: 428 CHI: -8.7
Selectivity Filter: QLLV CVV: 467 CHI: 8.3
Fasta sequence:
>tr|W8AR93|W8AR93_CERCA|Unreviewed|Ceratitis_capitata|253
MDALGDLLAPYSELIAKVAGTITTLQFLSGVLLLNDIRKRGRSDGYPPDPFLGGVVLSIL
TLKMGTLMGDSATILVNIVGFAISVVFLSAFYWFASNDFKMKIWSKIGIAGAFTVACLTY
AAYEDPHKIEFRFGMLITGILVFLVGSPLLSLNKIIEKKSTEGMPFPIILTGTLVTASWA
LYAISIKNPMMAYQNLFLLALGSIQLSLFAIYPNSSPLPESSVQHTPSTLEHKKSENKTS
IPSTTSVDSKKKN
Snake diagram with key positions labelled
Modeled Structuresback to top
Model start: 5 Model end: 214
Alignment file: W8AR93.pir
Inward Open:
Template: 5CTG.pdb
Model structure: W8AR93_inward.pdb
Procheck score ⇒ Ramachandran plot: 90.6% favored 6.6% allowed 2.2% week .6% disallowed
Outward Open:
Template: 5CTG_outward.pdb
Model structure: W8AR93_outward.pdb
Procheck score ⇒ Ramachandran plot: 93.4% favored 6.1% allowed .6% week .0% disallowed
Occluded:
Template: 5CTG_occluded.pdb
Model structure: W8AR93_occluded.pdb
Procheck score ⇒ Ramachandran plot: 92.3% favored 6.6% allowed 1.1% week .0% disallowed
Gene Informationback to top
Gene ID: 101463208 Total Exons: 3 Coding Exons: 3
The diagram below shows the position of Exon-junctions in the protein structure ( Loops and transmembrane helices ).
If more than 1 exon translates a single secondary-structure , only the final exon is represented in figure.
Point on the red bars to view exon number
Gene Ontologyback to top
GO:0016021 - integral component of membrane
GO:0005886 - plasma membrane
GO:0008643 - carbohydrate transport
Family Classificationback to top
Pfam: PF03083: MtN3_slv
Interpro: IPR018178: SWEET_insect. IPR004316: SWEET_sugar_transpr.
Panther: PTHR10791:SF5