Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : W5P0N7

dbSWEET id: dbswt_1257

Accession:   W5P0N7

Uniprot status:   Unreviewed

Organism:   Ovis aries

Kingdom:   Metazoa

Taxonomy back to top


Eukaryota ⇒ Metazoa ⇒ Chordata ⇒ Craniata ⇒ Vertebrata ⇒ Euteleostomi ⇒ Mammalia ⇒ Eutheria ⇒ Laurasiatheria ⇒ Cetartiodactyla ⇒ Ruminantia ⇒ Pecora ⇒ Bovidae ⇒ Caprinae ⇒ Ovis.

Sequence Information back to top


Sequence length:   226

Substrate Binding Site:   NNWN           CVV:   451       CHI:   -11.4

Selectivity Filter:   MNMT           CVV:   437       CHI:   -0.4

Fasta sequence:

>tr|W5P0N7|W5P0N7_SHEEP|Unreviewed|Ovis_aries|226
MEAGGLADSLLSGACVLFTLGMFSTGLSDLKHMRMTRSVDSVQFLPFLTTDVNNLSWLSY
GALKGNWTLIVVNAVGAVLQTLYILVYLHYCHRKRAVLLQTTTLLGVLVLGFAYFWLLVP
DPEMRLQHLGLFCSVFTISMYLSPLADLAKVIRTKSTQRLSFSLTIATLLTSASWTLYGF
RLKDPYIVVPNLPGILTSFIRFWLFWKYSPGARQELSASTNLREFT

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   1     Model end:   210

Alignment file: W5P0N7.pir

Inward Open:

Template:   5CTG.pdb

Model structure:  W5P0N7_inward.pdb

Procheck score ⇒ Ramachandran plot: 90.9% favored    7.5% allowed    1.1% week    .5% disallowed

Outward Open:

Template:   5CTG_outward.pdb

Model structure:  W5P0N7_outward.pdb

Procheck score ⇒ Ramachandran plot: 93.0% favored    5.3% allowed    1.1% week    .5% disallowed

Occluded:

Template:   5CTG_occluded.pdb

Model structure:  W5P0N7_occluded.pdb

Procheck score ⇒ Ramachandran plot: 93.0% favored    5.9% allowed    1.1% week    .0% disallowed

Gene Informationback to top


Not Available

Gene Ontologyback to top


GO:0005794 - Golgi apparatus

GO:0016021 - integral component of membrane

GO:0005886 - plasma membrane

GO:0042947 - glucoside transmembrane transporter activity

GO:0008643 - carbohydrate transport

GO:0045815 - positive regulation of gene expression epigenetic

Family Classificationback to top


Pfam:   PF03083: MtN3_slv 

Interpro:   IPR004316: SWEET_sugar_transpr. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur