Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : W5JQI5

dbSWEET id: dbswt_1256

Accession:   W5JQI5

Uniprot status:   Unreviewed

Organism:   Anopheles darlingi

Kingdom:   Metazoa

Taxonomy back to top


Eukaryota ⇒ Metazoa ⇒ Ecdysozoa ⇒ Arthropoda ⇒ Hexapoda ⇒ Insecta ⇒ Pterygota ⇒ Neoptera ⇒ Endopterygota ⇒ Diptera ⇒ Nematocera ⇒ Culicoidea ⇒ Culicidae ⇒ Anophelinae ⇒ Anopheles.

Sequence Information back to top


Sequence length:   228

Substrate Binding Site:   CNWN           CVV:   441       CHI:   -5.4

Selectivity Filter:   QFLV           CVV:   478       CHI:   7.3

Fasta sequence:

>tr|W5JQI5|W5JQI5_ANODA|Unreviewed|Anopheles_darlingi|228
MESIAVALQPHKDTVGLTAAIVTVIQFFGGVLAISEIRRRGSTAGFSVLPFLGGTAFCLL
NVQFGQMLRDDGMIRVNFIGLVLHLIYVCAFYLYTEGPRKTAVWGQIGLAGALTVGVLSY
VQYEDPKLVQFRFGVILTALLWTLVGMPLLGLGEILKKKSTAGLPFPMILLGSIVSFLWL
LYGIILRSNFLVVQNLVALALCAIQLSLFIIFPAESIKPPPSPAKKSN

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   5     Model end:   214

Alignment file: W5JQI5.pir

Inward Open:

Template:   5CTG.pdb

Model structure:  W5JQI5_inward.pdb

Procheck score ⇒ Ramachandran plot: 93.8% favored    4.5% allowed    1.7% week    .0% disallowed

Outward Open:

Template:   5CTG_outward.pdb

Model structure:  W5JQI5_outward.pdb

Procheck score ⇒ Ramachandran plot: 93.3% favored    5.6% allowed    1.1% week    .0% disallowed

Occluded:

Template:   5CTG_occluded.pdb

Model structure:  W5JQI5_occluded.pdb

Procheck score ⇒ Ramachandran plot: 92.1% favored    5.6% allowed    1.7% week    .6% disallowed

Gene Informationback to top


Not Available

Gene Ontologyback to top


GO:0016021 - integral component of membrane

GO:0005886 - plasma membrane

GO:0008643 - carbohydrate transport

Family Classificationback to top


Pfam:   PF03083: MtN3_slv 

Interpro:   IPR018178: SWEET_insect. IPR004316: SWEET_sugar_transpr. 

Panther:  PTHR10791:SF5

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur