| Basic Information |
| Taxanomy |
| Sequence Information |
| Modeled Structures |
| Gene Information |
| Gene Ontology |
| Family Classification |
Details : W5JNG5
dbSWEET id: dbswt_1255
Accession: W5JNG5
Uniprot status: Unreviewed
Organism: Anopheles darlingi
Kingdom: Metazoa
Taxonomy back to top
Eukaryota ⇒ Metazoa ⇒ Ecdysozoa ⇒ Arthropoda ⇒ Hexapoda ⇒ Insecta ⇒ Pterygota ⇒ Neoptera ⇒ Endopterygota ⇒ Diptera ⇒ Nematocera ⇒ Culicoidea ⇒ Culicidae ⇒ Anophelinae ⇒ Anopheles.
Sequence Information back to top
Sequence length: 229
Substrate Binding Site: CNWN CVV: 441 CHI: -5.4
Selectivity Filter: QSFV CVV: 427 CHI: 2.7
Fasta sequence:
>tr|W5JNG5|W5JNG5_ANODA|Unreviewed|Anopheles_darlingi|229
MEAILSKNTLASLSTVATVLQFLTGTIICRRYFKKKSTGDTSAFPFISGFLSCFMWLKYG
VLTEESTLILVNFIGSALFLAYTVIFFLFCVNKREVVRQIMVVSCVILSATLYTTFSADT
ERSVRVIGLLCCFLAVIFFASPLSTLAHVIRTQNTDSLPFPIIVASFFVCLLWTAYGVLI
NDLYVQIPNLLGGILAGVQLMLYVIYPKPKTSHGGGPRYSPLVSENPVL
Snake diagram with key positions labelled

Modeled Structuresback to top
Model start: 1 Model end: 208
Alignment file: W5JNG5.pir
Inward Open:
Template: 5CTG.pdb
Model structure: W5JNG5_inward.pdb
Procheck score ⇒ Ramachandran plot: 90.0% favored 8.4% allowed 1.1% week .5% disallowed
Outward Open:
Template: 5CTG_outward.pdb
Model structure: W5JNG5_outward.pdb
Procheck score ⇒ Ramachandran plot: 91.1% favored 7.4% allowed 1.6% week .0% disallowed
Occluded:
Template: 5CTG_occluded.pdb
Model structure: W5JNG5_occluded.pdb
Procheck score ⇒ Ramachandran plot: 92.1% favored 5.3% allowed 2.6% week .0% disallowed
Gene Ontologyback to top
GO:0016021 - integral component of membrane
GO:0008643 - carbohydrate transport
Family Classificationback to top
Pfam: PF03083: MtN3_slv
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA