| Basic Information |
| Taxanomy |
| Sequence Information |
| Modeled Structures |
| Gene Information |
| Gene Ontology |
| Family Classification |
Details : W5JGX7
dbSWEET id: dbswt_1254
Accession: W5JGX7
Uniprot status: Unreviewed
Organism: Anopheles darlingi
Kingdom: Metazoa
Taxonomy back to top
Eukaryota ⇒ Metazoa ⇒ Ecdysozoa ⇒ Arthropoda ⇒ Hexapoda ⇒ Insecta ⇒ Pterygota ⇒ Neoptera ⇒ Endopterygota ⇒ Diptera ⇒ Nematocera ⇒ Culicoidea ⇒ Culicidae ⇒ Anophelinae ⇒ Anopheles.
Sequence Information back to top
Sequence length: 224
Substrate Binding Site: TNWN CVV: 448 CHI: -8.6
Selectivity Filter: QLLV CVV: 467 CHI: 8.3
Fasta sequence:
>tr|W5JGX7|W5JGX7_ANODA|Unreviewed|Anopheles_darlingi|224
MEAISELLQPYKEHVGFTAGVLTVGQMFSGCFVCNDIRKKGTTDGFSPMPFIGGCGLTIL
FLQHGMLMGDSVMINSNLVGLAISFSYAAFFAFYTPAKERGSFWRASLWTTLFTFGVLLY
AKFENPAVVEDRFGMILTVLMLCLIGQPLIGLPEIIRRKSTEGLPFPMILSGTIVGLSWL
LYGVILNNVFVVLQNLAAVTLSGIQLALFAIYPSKPAAPSKKRN
Snake diagram with key positions labelled

Modeled Structuresback to top
Model start: 5 Model end: 214
Alignment file: W5JGX7.pir
Inward Open:
Template: 5CTG.pdb
Model structure: W5JGX7_inward.pdb
Procheck score ⇒ Ramachandran plot: 93.2% favored 5.7% allowed 1.1% week .0% disallowed
Outward Open:
Template: 5CTG_outward.pdb
Model structure: W5JGX7_outward.pdb
Procheck score ⇒ Ramachandran plot: 93.8% favored 5.1% allowed 1.1% week .0% disallowed
Occluded:
Template: 5CTG_occluded.pdb
Model structure: W5JGX7_occluded.pdb
Procheck score ⇒ Ramachandran plot: 92.0% favored 6.2% allowed 1.1% week .6% disallowed
Gene Ontologyback to top
GO:0016021 - integral component of membrane
GO:0005886 - plasma membrane
GO:0008643 - carbohydrate transport
Family Classificationback to top
Pfam: PF03083: MtN3_slv
Interpro: IPR018178: SWEET_insect. IPR004316: SWEET_sugar_transpr.
Panther: PTHR10791:SF5