Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : W5G2W0

dbSWEET id: dbswt_476

Accession:   W5G2W0

Uniprot status:   Unreviewed

Organism:   Triticum aestivum

Kingdom:   Plantae

Taxonomy back to top


Eukaryota ⇒ Viridiplantae ⇒ Streptophyta ⇒ Embryophyta ⇒ Tracheophyta ⇒ Spermatophyta ⇒ Magnoliophyta ⇒ Liliopsida ⇒ Poales ⇒ Poaceae ⇒ BOP clade ⇒ Pooideae ⇒ Triticodae ⇒ Triticeae ⇒ Triticinae ⇒ Triticum.

Sequence Information back to top


Sequence length:   245

Substrate Binding Site:   TNWN           CVV:   448       CHI:   -8.6

Selectivity Filter:   VNMN           CVV:   421       CHI:   -0.9

Fasta sequence:

>tr|W5G2W0|W5G2W0_WHEAT|Unreviewed|Triticum_aestivum|245
MNSTLFIIGVIGNIISVLVFISPIPTFWRIVRSRSTEDFEAAPYVLTLLNTLLWLYYGLT
KPDGLLIATVNGFGAVMETIYLVLFLVYAADKGKRVKTAKLVAVLDIGFFGVVFAATTFA
IGGLDIKIMVIGLICACLSVFMYGSPLAAVRRVITSRSVEYMPFFLSFFLFLNGGVWATY
AILDKDVFLGVPNGTGCFLGAIQLVIYAVYMNSRVASHSHGSDEAASLLSSEASKHGQHD
ASTRV

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   1     Model end:   212

Alignment file: W5G2W0.pir

Inward Open:

Template:   5CTG.pdb

Model structure:  W5G2W0_inward.pdb

Procheck score ⇒ Ramachandran plot: 90.7% favored    5.5% allowed    2.2% week    1.6% disallowed

Outward Open:

Template:   5CTG_outward.pdb

Model structure:  W5G2W0_outward.pdb

Procheck score ⇒ Ramachandran plot: 94.5% favored    4.9% allowed    .0% week    .5% disallowed

Occluded:

Template:   5CTG_occluded.pdb

Model structure:  W5G2W0_occluded.pdb

Procheck score ⇒ Ramachandran plot: 90.7% favored    6.6% allowed    1.6% week    1.1% disallowed

Gene Informationback to top


Not Available

Gene Ontologyback to top


GO:0016021 - integral component of membrane

GO:0005886 - plasma membrane

GO:0008643 - carbohydrate transport

Family Classificationback to top


Pfam:   PF03083: MtN3_slv. 

Interpro:   IPR004316: SWEET_sugar_transpr. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur