Basic Information |
Taxanomy |
Sequence Information |
Modeled Structures |
Gene Information |
Gene Ontology |
Family Classification |
Details : W5FPH6
dbSWEET id: dbswt_481
Accession: W5FPH6
Uniprot status: Unreviewed
Organism: Triticum aestivum
Kingdom: Plantae
Taxonomy back to top
Eukaryota ⇒ Viridiplantae ⇒ Streptophyta ⇒ Embryophyta ⇒ Tracheophyta ⇒ Spermatophyta ⇒ Magnoliophyta ⇒ Liliopsida ⇒ Poales ⇒ Poaceae ⇒ BOP clade ⇒ Pooideae ⇒ Triticodae ⇒ Triticeae ⇒ Triticinae ⇒ Triticum.
Sequence Information back to top
Sequence length: 282
Substrate Binding Site: TNWN CVV: 448 CHI: -8.6
Selectivity Filter: VNMN CVV: 421 CHI: -0.9
Fasta sequence:
>tr|W5FPH6|W5FPH6_WHEAT|Unreviewed|Triticum_aestivum|282
SLSLSLSLSLSHTHTHTHTHTHIYLSLFFLSLLFDHGASLGFAGNIISVLVFVSPIPTFW
RIVRSRSTEDFEAAPYVLTLLNTLLWLYYGLTKPDGLLIATVNGFGAVMETIYIALFLIY
AVDNAKRVKTAKLVAVLDIGFFGVVFAATTFAIGGLDMKIMVIGLICACLSVFMYGSPLT
AVRTVIASRSVEYMPFFLSFFLFLNGGVWATYAILDKDVFLGVPNGIGCFLGGIQLVIYA
IYRNSKVGSQSHDSDEAAYDASASLLSSEAGRHGQNDVSARV
Snake diagram with key positions labelled
Modeled Structuresback to top
Model start: 30 Model end: 244
Alignment file: W5FPH6.pir
Inward Open:
Template: 5CTG.pdb
Model structure: W5FPH6_inward.pdb
Procheck score ⇒ Ramachandran plot: 94.1% favored 4.3% allowed 1.1% week .5% disallowed
Outward Open:
Template: 5CTG_outward.pdb
Model structure: W5FPH6_outward.pdb
Procheck score ⇒ Ramachandran plot: 93.5% favored 5.9% allowed .0% week .5% disallowed
Occluded:
Template: 5CTG_occluded.pdb
Model structure: W5FPH6_occluded.pdb
Procheck score ⇒ Ramachandran plot: 91.4% favored 7.0% allowed 1.1% week .5% disallowed
Gene Ontologyback to top
GO:0016021 - integral component of membrane
GO:0005886 - plasma membrane
GO:0008643 - carbohydrate transport
Family Classificationback to top
Pfam: PF03083: MtN3_slv.
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA