| Basic Information |
| Taxanomy |
| Sequence Information |
| Modeled Structures |
| Gene Information |
| Gene Ontology |
| Family Classification |
Details : W5FF47
dbSWEET id: dbswt_52
Accession: W5FF47
Uniprot status: Unreviewed
Organism: Triticum aestivum
Kingdom: Plantae
Taxonomy back to top
Eukaryota ⇒ Viridiplantae ⇒ Streptophyta ⇒ Embryophyta ⇒ Tracheophyta ⇒ Spermatophyta ⇒ Magnoliophyta ⇒ Liliopsida ⇒ Poales ⇒ Poaceae ⇒ BOP clade ⇒ Pooideae ⇒ Triticodae ⇒ Triticeae ⇒ Triticinae ⇒ Triticum.
Sequence Information back to top
Sequence length: 287
Substrate Binding Site: CNWN CVV: 441 CHI: -5.4
Selectivity Filter: VSVS CVV: 356 CHI: 6.8
Fasta sequence:
>tr|W5FF47|W5FF47_WHEAT|Unreviewed|Triticum_aestivum|287
MADGLFSMAHPWASAFGILGNIISFLVFLAPTPTFLRVYRKKSTEGFSAVPYVVALFSCM
LWIFYALVKTNSSPLLTINAFGCVVEGFYILLYVVYAPRAARHRALAFFLLLDVAAFALI
VSVTVLLVPQPSRAKVLGSVCLAFSMAVFVAPLSVIFVVIKTKSAEYMPFSLSFFLTLSA
VAWFFYGLFTKDIYVTLPNVGGFFFGVAQMTLYFCYRKPDTSALVLPTGIHDVSTETAAQ
QEVELPEGTHPAVAMLTVSTLPMLAELQKMEQEISSPTPRKGYIKAF
Snake diagram with key positions labelled

Modeled Structuresback to top
Model start: 6 Model end: 218
Alignment file: W5FF47.pir
Inward Open:
Template: 5CTG.pdb
Model structure: W5FF47_inward.pdb
Procheck score ⇒ Ramachandran plot: 93.1% favored 5.3% allowed 1.1% week .5% disallowed
Outward Open:
Template: 5CTG_outward.pdb
Model structure: W5FF47_outward.pdb
Procheck score ⇒ Ramachandran plot: 94.2% favored 4.8% allowed 1.1% week .0% disallowed
Occluded:
Template: 5CTG_occluded.pdb
Model structure: W5FF47_occluded.pdb
Procheck score ⇒ Ramachandran plot: 94.2% favored 3.2% allowed 2.1% week .5% disallowed
Gene Ontologyback to top
GO:0016021 - integral component of membrane
GO:0005886 - plasma membrane
GO:0008643 - carbohydrate transport
Family Classificationback to top
Pfam: PF03083: MtN3_slv.
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA