| Basic Information |
| Taxanomy |
| Sequence Information |
| Modeled Structures |
| Gene Information |
| Gene Ontology |
| Family Classification |
Details : W5E5N5
dbSWEET id: dbswt_323
Accession: W5E5N5
Uniprot status: Unreviewed
Organism: Triticum aestivum
Kingdom: Plantae
Taxonomy back to top
Eukaryota ⇒ Viridiplantae ⇒ Streptophyta ⇒ Embryophyta ⇒ Tracheophyta ⇒ Spermatophyta ⇒ Magnoliophyta ⇒ Liliopsida ⇒ Poales ⇒ Poaceae ⇒ BOP clade ⇒ Pooideae ⇒ Triticodae ⇒ Triticeae ⇒ Triticinae ⇒ Triticum.
Sequence Information back to top
Sequence length: 311
Substrate Binding Site: ANWN CVV: 422 CHI: -6.1
Selectivity Filter: VSVS CVV: 356 CHI: 6.8
Fasta sequence:
>tr|W5E5N5|W5E5N5_WHEAT|Unreviewed|Triticum_aestivum|311
MGAVGSPLVFAMGILGNILSFLVILAPVPTFYRVYTRKSTESFQSVPYAMALLSAMLWLY
YALLTKDLLLLTINTVGCVVESAYLAIYLAYAPKQARAFTAKLVGIMNVALYGAMVCVLQ
LLVKDGESRVTIAGGIGSAFALAVFVAPLAIIRQVIGTKSVEFLPFWLSFFLTISAVVWF
FYGLLMKDFFVTPNVLGLLFGLAQMSLHLVYKNPKKKGAVSEVQVPADDEKNQLPLQQQQ
QQQAGTTAHVVAPIIEADEEVVNGREDDGGDKQQSVSVVDIVLPPPEEHPTLPPVDHPAP
LPPMRMAVEVV
Snake diagram with key positions labelled

Modeled Structuresback to top
Model start: 2 Model end: 213
Alignment file: W5E5N5.pir
Inward Open:
Template: 5CTG.pdb
Model structure: W5E5N5_inward.pdb
Procheck score ⇒ Ramachandran plot: 93.6% favored 4.3% allowed 1.6% week .5% disallowed
Outward Open:
Template: 5CTG_outward.pdb
Model structure: W5E5N5_outward.pdb
Procheck score ⇒ Ramachandran plot: 92.0% favored 7.0% allowed 1.1% week .0% disallowed
Occluded:
Template: 5CTG_occluded.pdb
Model structure: W5E5N5_occluded.pdb
Procheck score ⇒ Ramachandran plot: 92.5% favored 4.8% allowed 2.7% week .0% disallowed
Gene Ontologyback to top
GO:0016021 - integral component of membrane
GO:0005886 - plasma membrane
GO:0008643 - carbohydrate transport
Family Classificationback to top
Pfam: PF03083: MtN3_slv.
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA