Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : W5DXJ7

dbSWEET id: dbswt_325

Accession:   W5DXJ7

Uniprot status:   Unreviewed

Organism:   Triticum aestivum

Kingdom:   Plantae

Taxonomy back to top


Eukaryota ⇒ Viridiplantae ⇒ Streptophyta ⇒ Embryophyta ⇒ Tracheophyta ⇒ Spermatophyta ⇒ Magnoliophyta ⇒ Liliopsida ⇒ Poales ⇒ Poaceae ⇒ BOP clade ⇒ Pooideae ⇒ Triticodae ⇒ Triticeae ⇒ Triticinae ⇒ Triticum.

Sequence Information back to top


Sequence length:   311

Substrate Binding Site:   ANWN           CVV:   422       CHI:   -6.1

Selectivity Filter:   VSVS           CVV:   356       CHI:   6.8

Fasta sequence:

>tr|W5DXJ7|W5DXJ7_WHEAT|Unreviewed|Triticum_aestivum|311
MGAVGSPLVFAVGILGNILSFLVILAPVPTFYRVYTRKSTESFQSVPYAMALLSAMLWLY
YALLTKDLLLLTINTLGCVVESAYLAIYLAYAPKQARAFTVKLVCIMNMALYGAMVCVLQ
LLVKDGESRVTIAGGIGSAFALAVFVAPLAIIRQVIRTKSVEFLPFWLSFFLTISAVVWF
FYGLLMKDFFVAAPNVLGLLFGLAQMSLHLVYKNPKKKGAVSEVQVPADDEKNQLPLQQQ
QEAGTTAHVVAPIIEGDEEVVNGREDDVGGDKQQSVSVVDIVLPPPEEHPTLPPVDHPAP
LPPMRMAVEVV

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   2     Model end:   214

Alignment file: W5DXJ7.pir

Inward Open:

Template:   5CTG.pdb

Model structure:  W5DXJ7_inward.pdb

Procheck score ⇒ Ramachandran plot: 93.2% favored    5.3% allowed    1.6% week    .0% disallowed

Outward Open:

Template:   5CTG_outward.pdb

Model structure:  W5DXJ7_outward.pdb

Procheck score ⇒ Ramachandran plot: 92.6% favored    5.8% allowed    1.6% week    .0% disallowed

Occluded:

Template:   5CTG_occluded.pdb

Model structure:  W5DXJ7_occluded.pdb

Procheck score ⇒ Ramachandran plot: 93.7% favored    5.8% allowed    .5% week    .0% disallowed

Gene Informationback to top


Not Available

Gene Ontologyback to top


GO:0016021 - integral component of membrane

GO:0005886 - plasma membrane

GO:0008643 - carbohydrate transport

Family Classificationback to top


Pfam:   PF03083: MtN3_slv. 

Interpro:   IPR004316: SWEET_sugar_transpr. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur