| Basic Information |
| Taxanomy |
| Sequence Information |
| Modeled Structures |
| Gene Information |
| Gene Ontology |
| Family Classification |
Details : W5CT15
dbSWEET id: dbswt_598
Accession: W5CT15
Uniprot status: Unreviewed
Organism: Triticum aestivum
Kingdom: Plantae
Taxonomy back to top
Eukaryota ⇒ Viridiplantae ⇒ Streptophyta ⇒ Embryophyta ⇒ Tracheophyta ⇒ Spermatophyta ⇒ Magnoliophyta ⇒ Liliopsida ⇒ Poales ⇒ Poaceae ⇒ BOP clade ⇒ Pooideae ⇒ Triticodae ⇒ Triticeae ⇒ Triticinae ⇒ Triticum.
Sequence Information back to top
Sequence length: 231
Substrate Binding Site: CNFN CVV: 413 CHI: -1.7
Selectivity Filter: LNMM CVV: 468 CHI: 4.1
Fasta sequence:
>tr|W5CT15|W5CT15_WHEAT|Unreviewed|Triticum_aestivum|231
MDSLSLYEISCFAAGFAGNLFAFALFLSPVPTFKRILKAKSTEQFDGLPYLLSLLNCFIC
LWYGLPWVSDGRLLVATVNGTGAAFQLAYISLFFIYADSRKTRLRMVGLLVLLVCAFALV
AHASIAFFDQPTRQQFVGAVSMASLISMFASPLAVMGVVIRTECVEFMPFYLSLSTLLMS
ASFAVYGLLLRDLFIYLPNGLGVVLGATQLALYAYYSRKWRCKDSSAPLLA
Snake diagram with key positions labelled
Modeled Structuresback to top
Model start: 4 Model end: 218
Alignment file: W5CT15.pir
Inward Open:
Template: 5CTG.pdb
Model structure: W5CT15_inward.pdb
Procheck score ⇒ Ramachandran plot: 95.8% favored 2.6% allowed .5% week 1.1% disallowed
Outward Open:
Template: 5CTG_outward.pdb
Model structure: W5CT15_outward.pdb
Procheck score ⇒ Ramachandran plot: 94.7% favored 4.7% allowed .5% week .0% disallowed
Occluded:
Template: 5CTG_occluded.pdb
Model structure: W5CT15_occluded.pdb
Procheck score ⇒ Ramachandran plot: 92.1% favored 6.3% allowed 1.6% week .0% disallowed
Gene Ontologyback to top
GO:0016021 - integral component of membrane
GO:0005886 - plasma membrane
GO:0008643 - carbohydrate transport
Family Classificationback to top
Pfam: PF03083: MtN3_slv.
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA