Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : W4ZUX2

dbSWEET id: dbswt_526

Accession:   W4ZUX2

Uniprot status:   Unreviewed

Organism:   Triticum aestivum

Kingdom:   Plantae

Taxonomy back to top


Eukaryota ⇒ Viridiplantae ⇒ Streptophyta ⇒ Embryophyta ⇒ Tracheophyta ⇒ Spermatophyta ⇒ Magnoliophyta ⇒ Liliopsida ⇒ Poales ⇒ Poaceae ⇒ BOP clade ⇒ Pooideae ⇒ Triticodae ⇒ Triticeae ⇒ Triticinae ⇒ Triticum.

Sequence Information back to top


Sequence length:   246

Substrate Binding Site:   SSWS           CVV:   382       CHI:   -3.3

Selectivity Filter:   LSMT           CVV:   414       CHI:   4.2

Fasta sequence:

>tr|W4ZUX2|W4ZUX2_WHEAT|Unreviewed|Triticum_aestivum|246
MFPDLHVTTGIIGSVVCFLLYAAPILTFRRVIKKGSVEEYSCIPYILTLFSSLTYTWYGL
PVVSSGWENWTLSGISSLGVLFESTFISIYIWFAPREKKKLVMMMVSPILIIFGMAVFFS
IFSFHTHQMRKVFVGSIGLVASILMYGSPLVAVKQVIRTKSVEFMPFYLSLFSFLTSLLW
MLYGLLGKDPFLTAPSFIGCLMGILQLVVYCIYSKCKEAPKTNPDIEQADELKVVTSQDN
TKGQKP

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   1     Model end:   215

Alignment file: W4ZUX2.pir

Inward Open:

Template:   5CTG.pdb

Model structure:  W4ZUX2_inward.pdb

Procheck score ⇒ Ramachandran plot: 94.7% favored    4.3% allowed    .5% week    .5% disallowed

Outward Open:

Template:   5CTG_outward.pdb

Model structure:  W4ZUX2_outward.pdb

Procheck score ⇒ Ramachandran plot: 94.1% favored    4.3% allowed    1.1% week    .5% disallowed

Occluded:

Template:   5CTG_occluded.pdb

Model structure:  W4ZUX2_occluded.pdb

Procheck score ⇒ Ramachandran plot: 92.5% favored    7.0% allowed    .0% week    .5% disallowed

Gene Informationback to top


Not Available

Gene Ontologyback to top


GO:0016021 - integral component of membrane

GO:0005886 - plasma membrane

GO:0008643 - carbohydrate transport

Family Classificationback to top


Pfam:   PF03083: MtN3_slv. 

Interpro:   IPR004316: SWEET_sugar_transpr. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur