Basic Information |
Taxanomy |
Sequence Information |
Modeled Structures |
Gene Information |
Gene Ontology |
Family Classification |
Details : W4ZUX2
dbSWEET id: dbswt_526
Accession: W4ZUX2
Uniprot status: Unreviewed
Organism: Triticum aestivum
Kingdom: Plantae
Taxonomy back to top
Eukaryota ⇒ Viridiplantae ⇒ Streptophyta ⇒ Embryophyta ⇒ Tracheophyta ⇒ Spermatophyta ⇒ Magnoliophyta ⇒ Liliopsida ⇒ Poales ⇒ Poaceae ⇒ BOP clade ⇒ Pooideae ⇒ Triticodae ⇒ Triticeae ⇒ Triticinae ⇒ Triticum.
Sequence Information back to top
Sequence length: 246
Substrate Binding Site: SSWS CVV: 382 CHI: -3.3
Selectivity Filter: LSMT CVV: 414 CHI: 4.2
Fasta sequence:
>tr|W4ZUX2|W4ZUX2_WHEAT|Unreviewed|Triticum_aestivum|246
MFPDLHVTTGIIGSVVCFLLYAAPILTFRRVIKKGSVEEYSCIPYILTLFSSLTYTWYGL
PVVSSGWENWTLSGISSLGVLFESTFISIYIWFAPREKKKLVMMMVSPILIIFGMAVFFS
IFSFHTHQMRKVFVGSIGLVASILMYGSPLVAVKQVIRTKSVEFMPFYLSLFSFLTSLLW
MLYGLLGKDPFLTAPSFIGCLMGILQLVVYCIYSKCKEAPKTNPDIEQADELKVVTSQDN
TKGQKP
Snake diagram with key positions labelled
Modeled Structuresback to top
Model start: 1 Model end: 215
Alignment file: W4ZUX2.pir
Inward Open:
Template: 5CTG.pdb
Model structure: W4ZUX2_inward.pdb
Procheck score ⇒ Ramachandran plot: 94.7% favored 4.3% allowed .5% week .5% disallowed
Outward Open:
Template: 5CTG_outward.pdb
Model structure: W4ZUX2_outward.pdb
Procheck score ⇒ Ramachandran plot: 94.1% favored 4.3% allowed 1.1% week .5% disallowed
Occluded:
Template: 5CTG_occluded.pdb
Model structure: W4ZUX2_occluded.pdb
Procheck score ⇒ Ramachandran plot: 92.5% favored 7.0% allowed .0% week .5% disallowed
Gene Ontologyback to top
GO:0016021 - integral component of membrane
GO:0005886 - plasma membrane
GO:0008643 - carbohydrate transport
Family Classificationback to top
Pfam: PF03083: MtN3_slv.
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA