Basic Information |
Taxanomy |
Sequence Information |
Modeled Structures |
Gene Information |
Gene Ontology |
Family Classification |
Details : W4Z0R3
dbSWEET id: dbswt_1253
Accession: W4Z0R3
Uniprot status: Unreviewed
Organism: Strongylocentrotus purpuratus
Kingdom: Metazoa
Taxonomy back to top
Eukaryota ⇒ Metazoa ⇒ Echinodermata ⇒ Eleutherozoa ⇒ Echinozoa ⇒ Echinoidea ⇒ Euechinoidea ⇒ Echinacea ⇒ Echinoida ⇒ Strongylocentrotidae ⇒ Strongylocentrotus.
Sequence Information back to top
Sequence length: 216
Substrate Binding Site: GNWS CVV: 380 CHI: -5.6
Selectivity Filter: FNTT CVV: 417 CHI: -2.1
Fasta sequence:
>tr|W4Z0R3|W4Z0R3_STRPU|Unreviewed|Strongylocentrotus_purpuratus|216
MDTLSILSWICIVTTIGFFASGIPVFIPIVKSGSTGNVPFLPFLLGLMNGIACLWYGVLK
DDFTMIVVNTTGVVFHIFYVTTYLFCAKDRDSANQKTLLGGIFLAGIYVYFNHVIEERSV
VENQLGLTTCLMVLATNISPLAELGNAIRTRNSESFSAFMASAMFLTSLAWTFYGLLIDD
IYVQIPSVPGMVSGITQLALLGIFPSRGLEKRAKAD
Snake diagram with key positions labelled
Modeled Structuresback to top
Model start: 1 Model end: 206
Alignment file: W4Z0R3.pir
Inward Open:
Template: 5CTG.pdb
Model structure: W4Z0R3_inward.pdb
Procheck score ⇒ Ramachandran plot: 89.4% favored 7.8% allowed 1.1% week 1.7% disallowed
Outward Open:
Template: 5CTG_outward.pdb
Model structure: W4Z0R3_outward.pdb
Procheck score ⇒ Ramachandran plot: 92.2% favored 7.3% allowed .0% week .6% disallowed
Occluded:
Template: 5CTG_occluded.pdb
Model structure: W4Z0R3_occluded.pdb
Procheck score ⇒ Ramachandran plot: 92.2% favored 5.6% allowed .6% week 1.7% disallowed
Gene Informationback to top
Gene ID: 753750 Total Exons: 6 Coding Exons: 6
The diagram below shows the position of Exon-junctions in the protein structure ( Loops and transmembrane helices ).
If more than 1 exon translates a single secondary-structure , only the final exon is represented in figure.
Point on the red bars to view exon number
Gene Ontologyback to top
GO:0016021 - integral component of membrane
GO:0051119 - sugar transmembrane transporter activity
GO:0008643 - carbohydrate transport
Family Classificationback to top
Pfam: PF03083: MtN3_slv
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA