Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : W4Z0R3

dbSWEET id: dbswt_1253

Accession:   W4Z0R3

Uniprot status:   Unreviewed

Organism:   Strongylocentrotus purpuratus

Kingdom:   Metazoa

Taxonomy back to top


Eukaryota ⇒ Metazoa ⇒ Echinodermata ⇒ Eleutherozoa ⇒ Echinozoa ⇒ Echinoidea ⇒ Euechinoidea ⇒ Echinacea ⇒ Echinoida ⇒ Strongylocentrotidae ⇒ Strongylocentrotus.

Sequence Information back to top


Sequence length:   216

Substrate Binding Site:   GNWS           CVV:   380       CHI:   -5.6

Selectivity Filter:   FNTT           CVV:   417       CHI:   -2.1

Fasta sequence:

>tr|W4Z0R3|W4Z0R3_STRPU|Unreviewed|Strongylocentrotus_purpuratus|216
MDTLSILSWICIVTTIGFFASGIPVFIPIVKSGSTGNVPFLPFLLGLMNGIACLWYGVLK
DDFTMIVVNTTGVVFHIFYVTTYLFCAKDRDSANQKTLLGGIFLAGIYVYFNHVIEERSV
VENQLGLTTCLMVLATNISPLAELGNAIRTRNSESFSAFMASAMFLTSLAWTFYGLLIDD
IYVQIPSVPGMVSGITQLALLGIFPSRGLEKRAKAD

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   1     Model end:   206

Alignment file: W4Z0R3.pir

Inward Open:

Template:   5CTG.pdb

Model structure:  W4Z0R3_inward.pdb

Procheck score ⇒ Ramachandran plot: 89.4% favored    7.8% allowed    1.1% week    1.7% disallowed

Outward Open:

Template:   5CTG_outward.pdb

Model structure:  W4Z0R3_outward.pdb

Procheck score ⇒ Ramachandran plot: 92.2% favored    7.3% allowed    .0% week    .6% disallowed

Occluded:

Template:   5CTG_occluded.pdb

Model structure:  W4Z0R3_occluded.pdb

Procheck score ⇒ Ramachandran plot: 92.2% favored    5.6% allowed    .6% week    1.7% disallowed

Gene Informationback to top


Gene ID:   753750     Total Exons:   6     Coding Exons:   6

The diagram below shows the position of Exon-junctions in the protein structure ( Loops and transmembrane helices ).

If more than 1 exon translates a single secondary-structure , only the final exon is represented in figure.
Point on the red bars to view exon number

Gene Ontologyback to top


GO:0016021 - integral component of membrane

GO:0051119 - sugar transmembrane transporter activity

GO:0008643 - carbohydrate transport

Family Classificationback to top


Pfam:   PF03083: MtN3_slv 

Interpro:   IPR004316: SWEET_sugar_transpr. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur