| Basic Information |
| Taxanomy |
| Sequence Information |
| Modeled Structures |
| Gene Information |
| Gene Ontology |
| Family Classification |
Details : W4TDA2
dbSWEET id: dbswt_1968
Accession: W4TDA2
Uniprot status: Unreviewed
Organism: Chryseobacterium indologenes
Kingdom: Bacteria
Taxonomy back to top
Bacteria ⇒ Bacteroidetes ⇒ Flavobacteriia ⇒ Flavobacteriales ⇒ Flavobacteriaceae ⇒ Chryseobacterium.
Sequence Information back to top
Sequence length: 88
Substrate Binding Site: LNLN CVV: 440 CHI: 0.6
Selectivity Filter: SGSG CVV: 242 CHI: -2.4
Fasta sequence:
>tr|W4TDA2|W4TDA2_9FLAO|Unreviewed|Chryseobacterium indologenes|88
MNENLLGIIAGVLTSISMIPQLIKVIREKNVEDISLLMLLVLISGLSLWVWYGFVKDELP
IILSNAFAVLVNLSLLVCYIKYNKRKQF
Snake diagram with key positions labelled

Modeled Structuresback to top
Model start: 4 Model end: 81 Inward Open: Template: 4X5M.pdb Model structure: W4TDA2_inward.pdb Alignment file: W4TDA2_inw.pir Procheck score ⇒ Ramachandran plot: 92.8% favored 5.1% allowed 2.2% week .0% disallowed Outward Open: Template: 4X5N.pdb Model structure: W4TDA2_outward.pdb Alignment file: W4TDA2_out.pir Procheck score ⇒ Ramachandran plot: 95.7% favored 3.6% allowed .7% week .0% disallowed Occluded: Model structure: W4TDA2_occluded.pdb Alignment file: W4TDA2_occ.pir Procheck score ⇒ Ramachandran plot: 94.9% favored 3.6% allowed 1.4% week .0% disallowed
Family Classificationback to top
Pfam: PF03083: MtN3_slv
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA