Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : W4TDA2

dbSWEET id: dbswt_1968

Accession:   W4TDA2

Uniprot status:   Unreviewed

Organism:   Chryseobacterium indologenes

Kingdom:   Bacteria

Taxonomy back to top


Bacteria ⇒ Bacteroidetes ⇒ Flavobacteriia ⇒ Flavobacteriales ⇒ Flavobacteriaceae ⇒ Chryseobacterium.

Sequence Information back to top


Sequence length:   88

Substrate Binding Site:   LNLN           CVV:   440       CHI:   0.6

Selectivity Filter:   SGSG           CVV:   242       CHI:   -2.4

Fasta sequence:

>tr|W4TDA2|W4TDA2_9FLAO|Unreviewed|Chryseobacterium indologenes|88
MNENLLGIIAGVLTSISMIPQLIKVIREKNVEDISLLMLLVLISGLSLWVWYGFVKDELP
IILSNAFAVLVNLSLLVCYIKYNKRKQF

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   4     Model end:   81

Inward Open:

Template:   4X5M.pdb

Model structure:  W4TDA2_inward.pdb    Alignment file: W4TDA2_inw.pir

Procheck score ⇒ Ramachandran plot: 92.8% favored    5.1% allowed    2.2% week    .0% disallowed

Outward Open:

Template:   4X5N.pdb

Model structure:  W4TDA2_outward.pdb    Alignment file: W4TDA2_out.pir

Procheck score ⇒ Ramachandran plot: 95.7% favored    3.6% allowed    .7% week    .0% disallowed

Occluded:

Template:   4QNC.pdb      4RNG.pdb

Model structure:  W4TDA2_occluded.pdb    Alignment file: W4TDA2_occ.pir

Procheck score ⇒ Ramachandran plot: 94.9% favored    3.6% allowed    1.4% week    .0% disallowed

Gene Informationback to top


Not Available

Gene Ontologyback to top


GO:0016021 - integral component of membrane

Family Classificationback to top


Pfam:   PF03083: MtN3_slv 

Interpro:   IPR004316: SWEET_sugar_transpr. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur