Basic Information |
Taxanomy |
Sequence Information |
Modeled Structures |
Gene Information |
Gene Ontology |
Family Classification |
Details : W3Y5L2
dbSWEET id: dbswt_1967
Accession: W3Y5L2
Uniprot status: Unreviewed
Organism: Veillonella
Kingdom: Bacteria
Taxonomy back to top
Bacteria ⇒ Firmicutes ⇒ Negativicutes ⇒ Veillonellales ⇒ Veillonellaceae ⇒ Veillonella.
Sequence Information back to top
Sequence length: 88
Substrate Binding Site: CNCN CVV: 364 CHI: -2
Selectivity Filter: SNSN CVV: 338 CHI: -8.6
Fasta sequence:
>tr|W3Y5L2|W3Y5L2_9FIRM|Unreviewed|Veillonella|88
MTRVKFMENLGKVATVTAVAMYVSYFPQIMNNLAHPGTGDWIQPLVAAINCTLWVLYGLF
KEHRDLPVALANAPGIFFGLAAAITALM
Snake diagram with key positions labelled
Modeled Structuresback to top
Model start: 13 Model end: 88 Inward Open: Template: 4X5M.pdb Model structure: W3Y5L2_inward.pdb Alignment file: W3Y5L2_inw.pir Procheck score ⇒ Ramachandran plot: 96.0% favored 4.0% allowed .0% week .0% disallowed Outward Open: Template: 4X5N.pdb Model structure: W3Y5L2_outward.pdb Alignment file: W3Y5L2_out.pir Procheck score ⇒ Ramachandran plot: 92.1% favored 4.8% allowed 2.4% week .8% disallowed Occluded: Model structure: W3Y5L2_occluded.pdb Alignment file: W3Y5L2_occ.pir Procheck score ⇒ Ramachandran plot: 92.1% favored 7.9% allowed .0% week .0% disallowed
Family Classificationback to top
Pfam: PF03083: MtN3_slv
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA