Basic Information |
Taxanomy |
Sequence Information |
Modeled Structures |
Gene Information |
Gene Ontology |
Family Classification |
Details : W3RQA5
dbSWEET id: dbswt_1966
Accession: W3RQA5
Uniprot status: Unreviewed
Organism: Afipia
Kingdom: Bacteria
Taxonomy back to top
Bacteria ⇒ Proteobacteria ⇒ Alphaproteobacteria ⇒ Rhizobiales ⇒ Bradyrhizobiaceae ⇒ Afipia.
Sequence Information back to top
Sequence length: 83
Substrate Binding Site: LNLN CVV: 440 CHI: 0.6
Selectivity Filter: CGCG CVV: 268 CHI: 4.2
Fasta sequence:
>tr|W3RQA5|W3RQA5_9BRAD|Unreviewed|Afipia|83
MPVSWFGAIGATLTTVCWLPQAVRLIRHKNTQAISLPTNLIFFAGLFFWLVYGIAIGDWP
LIAANGVSIVLTTIIVAMKLRYG
Snake diagram with key positions labelled
Modeled Structuresback to top
Model start: 4 Model end: 81 Inward Open: Template: 4X5M.pdb Model structure: W3RQA5_inward.pdb Alignment file: W3RQA5_inw.pir Procheck score ⇒ Ramachandran plot: 94.7% favored 3.8% allowed 1.5% week .0% disallowed Outward Open: Template: 4X5N.pdb Model structure: W3RQA5_outward.pdb Alignment file: W3RQA5_out.pir Procheck score ⇒ Ramachandran plot: 90.9% favored 6.8% allowed 2.3% week .0% disallowed Occluded: Model structure: W3RQA5_occluded.pdb Alignment file: W3RQA5_occ.pir Procheck score ⇒ Ramachandran plot: 97.7% favored 2.3% allowed .0% week .0% disallowed
Family Classificationback to top
Pfam: PF03083: MtN3_slv
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA