Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : W3RQA5

dbSWEET id: dbswt_1966

Accession:   W3RQA5

Uniprot status:   Unreviewed

Organism:   Afipia

Kingdom:   Bacteria

Taxonomy back to top


Bacteria ⇒ Proteobacteria ⇒ Alphaproteobacteria ⇒ Rhizobiales ⇒ Bradyrhizobiaceae ⇒ Afipia.

Sequence Information back to top


Sequence length:   83

Substrate Binding Site:   LNLN           CVV:   440       CHI:   0.6

Selectivity Filter:   CGCG           CVV:   268       CHI:   4.2

Fasta sequence:

>tr|W3RQA5|W3RQA5_9BRAD|Unreviewed|Afipia|83
MPVSWFGAIGATLTTVCWLPQAVRLIRHKNTQAISLPTNLIFFAGLFFWLVYGIAIGDWP
LIAANGVSIVLTTIIVAMKLRYG

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   4     Model end:   81

Inward Open:

Template:   4X5M.pdb

Model structure:  W3RQA5_inward.pdb    Alignment file: W3RQA5_inw.pir

Procheck score ⇒ Ramachandran plot: 94.7% favored    3.8% allowed    1.5% week    .0% disallowed

Outward Open:

Template:   4X5N.pdb

Model structure:  W3RQA5_outward.pdb    Alignment file: W3RQA5_out.pir

Procheck score ⇒ Ramachandran plot: 90.9% favored    6.8% allowed    2.3% week    .0% disallowed

Occluded:

Template:   4QNC.pdb      4RNG.pdb

Model structure:  W3RQA5_occluded.pdb    Alignment file: W3RQA5_occ.pir

Procheck score ⇒ Ramachandran plot: 97.7% favored    2.3% allowed    .0% week    .0% disallowed

Gene Informationback to top


Not Available

Gene Ontologyback to top


GO:0016021 - integral component of membrane

Family Classificationback to top


Pfam:   PF03083: MtN3_slv 

Interpro:   IPR004316: SWEET_sugar_transpr. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur