Basic Information |
Taxanomy |
Sequence Information |
Modeled Structures |
Gene Information |
Gene Ontology |
Family Classification |
Details : W2U145
dbSWEET id: dbswt_1252
Accession: W2U145
Uniprot status: Unreviewed
Organism: Necator americanus
Kingdom: Metazoa
Taxonomy back to top
Eukaryota ⇒ Metazoa ⇒ Ecdysozoa ⇒ Nematoda ⇒ Chromadorea ⇒ Rhabditida ⇒ Strongylida ⇒ Ancylostomatoidea ⇒ Ancylostomatidae ⇒ Bunostominae ⇒ Necator.
Sequence Information back to top
Sequence length: 230
Substrate Binding Site: TNWN CVV: 448 CHI: -8.6
Selectivity Filter: FTSL CVV: 425 CHI: 5.1
Fasta sequence:
>tr|W2U145|W2U145_NECAM|Unreviewed|Necator_americanus|230
MELTPMSIFTSWLTVISVSFTLLPFMMVLDWRRRGTADGFSSVNFVLPLLTTSCWLKHGH
MTNDNTNITINTINIGFFIFYILCFAYYQPKRKYLFGQLFVCATVLKLLFTYVDMHSGFF
QASDVAADVMGSIAAASQIASLAGGVYEIKRAISFGHTEYLPALFQYAIFFLVLQWLAFG
ILTGNKYIAIANVAALMVNVATISLYFIYPPLTWRVPIIGTGPQQREKKE
Snake diagram with key positions labelled
Modeled Structuresback to top
Model start: 1 Model end: 211
Alignment file: W2U145.pir
Inward Open:
Template: 5CTG.pdb
Model structure: W2U145_inward.pdb
Procheck score ⇒ Ramachandran plot: 91.6% favored 5.2% allowed 1.6% week 1.6% disallowed
Outward Open:
Template: 5CTG_outward.pdb
Model structure: W2U145_outward.pdb
Procheck score ⇒ Ramachandran plot: 94.2% favored 5.2% allowed .0% week .5% disallowed
Occluded:
Template: 5CTG_occluded.pdb
Model structure: W2U145_occluded.pdb
Procheck score ⇒ Ramachandran plot: 91.6% favored 7.3% allowed 1.0% week .0% disallowed
Gene Informationback to top
Gene ID: 25341293 Total Exons: 7 Coding Exons: 7
The diagram below shows the position of Exon-junctions in the protein structure ( Loops and transmembrane helices ).
If more than 1 exon translates a single secondary-structure , only the final exon is represented in figure.
Point on the red bars to view exon number
Gene Ontologyback to top
GO:0016021 - integral component of membrane
GO:0008643 - carbohydrate transport
Family Classificationback to top
Pfam: PF03083: MtN3_slv
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA