Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : W2U145

dbSWEET id: dbswt_1252

Accession:   W2U145

Uniprot status:   Unreviewed

Organism:   Necator americanus

Kingdom:   Metazoa

Taxonomy back to top


Eukaryota ⇒ Metazoa ⇒ Ecdysozoa ⇒ Nematoda ⇒ Chromadorea ⇒ Rhabditida ⇒ Strongylida ⇒ Ancylostomatoidea ⇒ Ancylostomatidae ⇒ Bunostominae ⇒ Necator.

Sequence Information back to top


Sequence length:   230

Substrate Binding Site:   TNWN           CVV:   448       CHI:   -8.6

Selectivity Filter:   FTSL           CVV:   425       CHI:   5.1

Fasta sequence:

>tr|W2U145|W2U145_NECAM|Unreviewed|Necator_americanus|230
MELTPMSIFTSWLTVISVSFTLLPFMMVLDWRRRGTADGFSSVNFVLPLLTTSCWLKHGH
MTNDNTNITINTINIGFFIFYILCFAYYQPKRKYLFGQLFVCATVLKLLFTYVDMHSGFF
QASDVAADVMGSIAAASQIASLAGGVYEIKRAISFGHTEYLPALFQYAIFFLVLQWLAFG
ILTGNKYIAIANVAALMVNVATISLYFIYPPLTWRVPIIGTGPQQREKKE

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   1     Model end:   211

Alignment file: W2U145.pir

Inward Open:

Template:   5CTG.pdb

Model structure:  W2U145_inward.pdb

Procheck score ⇒ Ramachandran plot: 91.6% favored    5.2% allowed    1.6% week    1.6% disallowed

Outward Open:

Template:   5CTG_outward.pdb

Model structure:  W2U145_outward.pdb

Procheck score ⇒ Ramachandran plot: 94.2% favored    5.2% allowed    .0% week    .5% disallowed

Occluded:

Template:   5CTG_occluded.pdb

Model structure:  W2U145_occluded.pdb

Procheck score ⇒ Ramachandran plot: 91.6% favored    7.3% allowed    1.0% week    .0% disallowed

Gene Informationback to top


Gene ID:   25341293     Total Exons:   7     Coding Exons:   7

The diagram below shows the position of Exon-junctions in the protein structure ( Loops and transmembrane helices ).

If more than 1 exon translates a single secondary-structure , only the final exon is represented in figure.
Point on the red bars to view exon number

Gene Ontologyback to top


GO:0016021 - integral component of membrane

GO:0008643 - carbohydrate transport

Family Classificationback to top


Pfam:   PF03083: MtN3_slv 

Interpro:   IPR004316: SWEET_sugar_transpr. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur