Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : W2CIB6

dbSWEET id: dbswt_1965

Accession:   W2CIB6

Uniprot status:   Unreviewed

Organism:   Tannerella

Kingdom:   Bacteria

Taxonomy back to top


Bacteria ⇒ Bacteroidetes ⇒ Bacteroidia ⇒ Bacteroidales ⇒ Porphyromonadaceae ⇒ Tannerella.

Sequence Information back to top


Sequence length:   86

Substrate Binding Site:   CNCN           CVV:   364       CHI:   -2

Selectivity Filter:   SNSN           CVV:   338       CHI:   -8.6

Fasta sequence:

>tr|W2CIB6|W2CIB6_9PORP|Unreviewed|Tannerella|86
MNEKWFRILAIAATCASILMYVSYISQIQMNLSGQKGTPVQPLCAAFNCMLWTTYGLFKK
PSKDWPIILANIPGIILGIITFATSF

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   10     Model end:   87

Inward Open:

Template:   4X5M.pdb

Model structure:  W2CIB6_inward.pdb    Alignment file: W2CIB6_inw.pir

Procheck score ⇒ Ramachandran plot: 90.8% favored    6.2% allowed    3.1% week    .0% disallowed

Outward Open:

Template:   4X5N.pdb

Model structure:  W2CIB6_outward.pdb    Alignment file: W2CIB6_out.pir

Procheck score ⇒ Ramachandran plot: 87.7% favored    9.2% allowed    2.3% week    .8% disallowed

Occluded:

Template:   4QNC.pdb      4RNG.pdb

Model structure:  W2CIB6_occluded.pdb    Alignment file: W2CIB6_occ.pir

Procheck score ⇒ Ramachandran plot: 86.9% favored    9.2% allowed    2.3% week    1.5% disallowed

Gene Informationback to top


Not Available

Gene Ontologyback to top


GO:0016021 - integral component of membrane

Family Classificationback to top


Pfam:   PF03083: MtN3_slv 

Interpro:   IPR004316: SWEET_sugar_transpr. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur