Basic Information |
Taxanomy |
Sequence Information |
Modeled Structures |
Gene Information |
Gene Ontology |
Family Classification |
Details : W2CIB6
dbSWEET id: dbswt_1965
Accession: W2CIB6
Uniprot status: Unreviewed
Organism: Tannerella
Kingdom: Bacteria
Taxonomy back to top
Bacteria ⇒ Bacteroidetes ⇒ Bacteroidia ⇒ Bacteroidales ⇒ Porphyromonadaceae ⇒ Tannerella.
Sequence Information back to top
Sequence length: 86
Substrate Binding Site: CNCN CVV: 364 CHI: -2
Selectivity Filter: SNSN CVV: 338 CHI: -8.6
Fasta sequence:
>tr|W2CIB6|W2CIB6_9PORP|Unreviewed|Tannerella|86
MNEKWFRILAIAATCASILMYVSYISQIQMNLSGQKGTPVQPLCAAFNCMLWTTYGLFKK
PSKDWPIILANIPGIILGIITFATSF
Snake diagram with key positions labelled
Modeled Structuresback to top
Model start: 10 Model end: 87 Inward Open: Template: 4X5M.pdb Model structure: W2CIB6_inward.pdb Alignment file: W2CIB6_inw.pir Procheck score ⇒ Ramachandran plot: 90.8% favored 6.2% allowed 3.1% week .0% disallowed Outward Open: Template: 4X5N.pdb Model structure: W2CIB6_outward.pdb Alignment file: W2CIB6_out.pir Procheck score ⇒ Ramachandran plot: 87.7% favored 9.2% allowed 2.3% week .8% disallowed Occluded: Model structure: W2CIB6_occluded.pdb Alignment file: W2CIB6_occ.pir Procheck score ⇒ Ramachandran plot: 86.9% favored 9.2% allowed 2.3% week 1.5% disallowed
Family Classificationback to top
Pfam: PF03083: MtN3_slv
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA