| Basic Information |
| Taxanomy |
| Sequence Information |
| Modeled Structures |
| Gene Information |
| Gene Ontology |
| Family Classification |
Details : W2CEZ4
dbSWEET id: dbswt_1964
Accession: W2CEZ4
Uniprot status: Unreviewed
Organism: Tannerella
Kingdom: Bacteria
Taxonomy back to top
Bacteria ⇒ Bacteroidetes ⇒ Bacteroidia ⇒ Bacteroidales ⇒ Porphyromonadaceae ⇒ Tannerella.
Sequence Information back to top
Sequence length: 86
Substrate Binding Site: CNCN CVV: 364 CHI: -2
Selectivity Filter: SNSN CVV: 338 CHI: -8.6
Fasta sequence:
>tr|W2CEZ4|W2CEZ4_9PORP|Unreviewed|Tannerella|86
MNEKWFRILAIVATCASILMYVSYISQIQMNLSGQKGTPVQPLCAAFNCMLWTTYGLFKK
PSKDWPIILANIPGIILGIITFATSF
Snake diagram with key positions labelled

Modeled Structuresback to top
Model start: 10 Model end: 87 Inward Open: Template: 4X5M.pdb Model structure: W2CEZ4_inward.pdb Alignment file: W2CEZ4_inw.pir Procheck score ⇒ Ramachandran plot: 83.1% favored 12.3% allowed 3.8% week .8% disallowed Outward Open: Template: 4X5N.pdb Model structure: W2CEZ4_outward.pdb Alignment file: W2CEZ4_out.pir Procheck score ⇒ Ramachandran plot: 90.8% favored 6.9% allowed 2.3% week .0% disallowed Occluded: Model structure: W2CEZ4_occluded.pdb Alignment file: W2CEZ4_occ.pir Procheck score ⇒ Ramachandran plot: 90.0% favored 6.2% allowed 3.1% week .8% disallowed
Family Classificationback to top
Pfam: PF03083: MtN3_slv
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA