Basic Information |
Taxanomy |
Sequence Information |
Modeled Structures |
Gene Information |
Gene Ontology |
Family Classification |
Details : W1VSK7
dbSWEET id: dbswt_1963
Accession: W1VSK7
Uniprot status: Unreviewed
Organism: Streptococcus parasanguinis
Kingdom: Bacteria
Taxonomy back to top
Bacteria ⇒ Firmicutes ⇒ Bacilli ⇒ Lactobacillales ⇒ Streptococcaceae ⇒ Streptococcus.
Sequence Information back to top
Sequence length: 87
Substrate Binding Site: CNCN CVV: 364 CHI: -2
Selectivity Filter: ASAS CVV: 280 CHI: 2
Fasta sequence:
>tr|W1VSK7|W1VSK7_STRPA|Unreviewed|Streptococcus parasanguinis|87
MTKQRINQIVGSIGAFIGIIVFIAYIPQIFANLQGNKAQPFQPLSAAVSCLIWVIYGWTK
EPKKDWILIIPNSAGVILGGLTFLTAL
Snake diagram with key positions labelled
Modeled Structuresback to top
Model start: 11 Model end: 88 Inward Open: Template: 4X5M.pdb Model structure: W1VSK7_inward.pdb Alignment file: W1VSK7_inw.pir Procheck score ⇒ Ramachandran plot: 84.9% favored 11.9% allowed 1.6% week 1.6% disallowed Outward Open: Template: 4X5N.pdb Model structure: W1VSK7_outward.pdb Alignment file: W1VSK7_out.pir Procheck score ⇒ Ramachandran plot: 92.1% favored 7.1% allowed .8% week .0% disallowed Occluded: Model structure: W1VSK7_occluded.pdb Alignment file: W1VSK7_occ.pir Procheck score ⇒ Ramachandran plot: 88.1% favored 7.9% allowed 4.0% week .0% disallowed
Gene Ontologyback to top
GO:0016021 - integral component of membrane
GO:0004180 - carboxypeptidase activity
Family Classificationback to top
Pfam: PF03083: MtN3_slv
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA