| Basic Information |
| Taxanomy |
| Sequence Information |
| Modeled Structures |
| Gene Information |
| Gene Ontology |
| Family Classification |
Details : W1VHP3
dbSWEET id: dbswt_1962
Accession: W1VHP3
Uniprot status: Unreviewed
Organism: Streptococcus parasanguinis
Kingdom: Bacteria
Taxonomy back to top
Bacteria ⇒ Firmicutes ⇒ Bacilli ⇒ Lactobacillales ⇒ Streptococcaceae ⇒ Streptococcus.
Sequence Information back to top
Sequence length: 87
Substrate Binding Site: CNCN CVV: 364 CHI: -2
Selectivity Filter: ASAS CVV: 280 CHI: 2
Fasta sequence:
>tr|W1VHP3|W1VHP3_STRPA|Unreviewed|Streptococcus parasanguinis|87
MTKQKINRIVGSIGAFIGIIVFIAYIPQIIANLQGNKAQPFQPLSAAISCLIWVIYGWTK
EPKKDWILIIPNSAGVILGGITFLTSL
Snake diagram with key positions labelled

Modeled Structuresback to top
Model start: 11 Model end: 88 Inward Open: Template: 4X5M.pdb Model structure: W1VHP3_inward.pdb Alignment file: W1VHP3_inw.pir Procheck score ⇒ Ramachandran plot: 89.7% favored 7.9% allowed .8% week 1.6% disallowed Outward Open: Template: 4X5N.pdb Model structure: W1VHP3_outward.pdb Alignment file: W1VHP3_out.pir Procheck score ⇒ Ramachandran plot: 88.1% favored 11.1% allowed .8% week .0% disallowed Occluded: Model structure: W1VHP3_occluded.pdb Alignment file: W1VHP3_occ.pir Procheck score ⇒ Ramachandran plot: 88.1% favored 8.7% allowed 3.2% week .0% disallowed
Gene Ontologyback to top
GO:0016021 - integral component of membrane
GO:0004180 - carboxypeptidase activity
Family Classificationback to top
Pfam: PF03083: MtN3_slv
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA