| Basic Information |
| Taxanomy |
| Sequence Information |
| Modeled Structures |
| Gene Information |
| Gene Ontology |
| Family Classification |
Details : W1UTW5
dbSWEET id: dbswt_1960
Accession: W1UTW5
Uniprot status: Unreviewed
Organism: Veillonella dispar
Kingdom: Bacteria
Taxonomy back to top
Bacteria ⇒ Firmicutes ⇒ Negativicutes ⇒ Veillonellales ⇒ Veillonellaceae ⇒ Veillonella.
Sequence Information back to top
Sequence length: 88
Substrate Binding Site: CNCN CVV: 364 CHI: -2
Selectivity Filter: SNSN CVV: 338 CHI: -8.6
Fasta sequence:
>tr|W1UTW5|W1UTW5_9FIRM|Unreviewed|Veillonella dispar|88
MNRVKFMENLGKVATVTAVAMYVSYFPQIMNNLAHPGTGDWIQPLVAAINCTLWVLYGLF
KEHRDIPVALANAPGIFFGLAAAITALM
Snake diagram with key positions labelled

Modeled Structuresback to top
Model start: 11 Model end: 88 Inward Open: Template: 4X5M.pdb Model structure: W1UTW5_inward.pdb Alignment file: W1UTW5_inw.pir Procheck score ⇒ Ramachandran plot: 96.9% favored 3.1% allowed .0% week .0% disallowed Outward Open: Template: 4X5N.pdb Model structure: W1UTW5_outward.pdb Alignment file: W1UTW5_out.pir Procheck score ⇒ Ramachandran plot: 91.5% favored 5.4% allowed 3.1% week .0% disallowed Occluded: Model structure: W1UTW5_occluded.pdb Alignment file: W1UTW5_occ.pir Procheck score ⇒ Ramachandran plot: 90.8% favored 7.7% allowed 1.5% week .0% disallowed
Family Classificationback to top
Pfam: PF03083: MtN3_slv
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA