| Basic Information |
| Taxanomy |
| Sequence Information |
| Modeled Structures |
| Gene Information |
| Gene Ontology |
| Family Classification |
Details : W1TZ81
dbSWEET id: dbswt_1959
Accession: W1TZ81
Uniprot status: Unreviewed
Organism: Streptococcus anginosus
Kingdom: Bacteria
Taxonomy back to top
Bacteria ⇒ Firmicutes ⇒ Bacilli ⇒ Lactobacillales ⇒ Streptococcaceae ⇒ Streptococcus ⇒ Streptococcus anginosus group.
Sequence Information back to top
Sequence length: 81
Substrate Binding Site: CNCN CVV: 364 CHI: -2
Selectivity Filter: SNSN CVV: 338 CHI: -8.6
Fasta sequence:
>tr|W1TZ81|W1TZ81_STRAP|Unreviewed|Streptococcus anginosus|81
MKMIGWVATFMSVMMYVSYIPQIMDNLAGHKGNFIQPLVVAINCSLWVYYGLFKKERDLP
LATANAPGIVFGFITVLTAMF
Snake diagram with key positions labelled

Modeled Structuresback to top
Model start: 5 Model end: 81 Inward Open: Template: 4X5M.pdb Model structure: W1TZ81_inward.pdb Alignment file: W1TZ81_inw.pir Procheck score ⇒ Ramachandran plot: 90.8% favored 6.2% allowed 1.5% week 1.5% disallowed Outward Open: Template: 4X5N.pdb Model structure: W1TZ81_outward.pdb Alignment file: W1TZ81_out.pir Procheck score ⇒ Ramachandran plot: 93.1% favored 6.2% allowed .8% week .0% disallowed Occluded: Model structure: W1TZ81_occluded.pdb Alignment file: W1TZ81_occ.pir Procheck score ⇒ Ramachandran plot: 91.5% favored 6.2% allowed 1.5% week .8% disallowed
Family Classificationback to top
Pfam: PF03083: MtN3_slv
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA