Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : W1Q131

dbSWEET id: dbswt_525

Accession:   W1Q131

Uniprot status:   Unreviewed

Organism:   Amborella trichopoda

Kingdom:   Plantae

Taxonomy back to top


Eukaryota ⇒ Viridiplantae ⇒ Streptophyta ⇒ Embryophyta ⇒ Tracheophyta ⇒ Spermatophyta ⇒ Magnoliophyta ⇒ basal Magnoliophyta ⇒ Amborellales ⇒ Amborellaceae ⇒ Amborella.

Sequence Information back to top


Sequence length:   267

Substrate Binding Site:   CNWN           CVV:   441       CHI:   -5.4

Selectivity Filter:   LNMT           CVV:   437       CHI:   1.5

Fasta sequence:

>tr|W1Q131|W1Q131_AMBTC|Unreviewed|Amborella_trichopoda|267
MAFIFAREDSYWSSSLFGGLLSGEFPNTITISDLHLLVGIIGNATAFLLYTAPMLTFRGV
IEKRSTEEFSCVPYIISLFNCLLYTWYGFPVVSDKWENITLLTINGFGVLLETSFIAIYF
WFAPRQKKRLVSFLVFAVLLVFLTTASISAFFIHDHPHRKALVGSVAVVASATMYSSPLV
AIGRVVQTQSVEFMPFYLSLFSFFTSSLWMAYGFLGNDLFIASPNFVGVPMAFLQLVVYY
TYRKKKEKAREYEEADVEQKVALLVKD

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   28     Model end:   244

Alignment file: W1Q131.pir

Inward Open:

Template:   5CTG.pdb

Model structure:  W1Q131_inward.pdb

Procheck score ⇒ Ramachandran plot: 93.8% favored    4.1% allowed    1.0% week    1.0% disallowed

Outward Open:

Template:   5CTG_outward.pdb

Model structure:  W1Q131_outward.pdb

Procheck score ⇒ Ramachandran plot: 94.8% favored    4.6% allowed    .0% week    .5% disallowed

Occluded:

Template:   5CTG_occluded.pdb

Model structure:  W1Q131_occluded.pdb

Procheck score ⇒ Ramachandran plot: 92.8% favored    6.2% allowed    .5% week    .5% disallowed

Gene Informationback to top


Gene ID:   18442367     Total Exons:   7     Coding Exons:   7

The diagram below shows the position of Exon-junctions in the protein structure ( Loops and transmembrane helices ).

If more than 1 exon translates a single secondary-structure , only the final exon is represented in figure.
Point on the red bars to view exon number

Gene Ontologyback to top


GO:0016021 - integral component of membrane

GO:0005886 - plasma membrane

GO:0008643 - carbohydrate transport

Family Classificationback to top


Pfam:   PF03083: MtN3_slv. 

Interpro:   IPR004316: SWEET_sugar_transpr. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur