| Basic Information |
| Taxanomy |
| Sequence Information |
| Modeled Structures |
| Gene Information |
| Gene Ontology |
| Family Classification |
Details : W1Q131
dbSWEET id: dbswt_525
Accession: W1Q131
Uniprot status: Unreviewed
Organism: Amborella trichopoda
Kingdom: Plantae
Taxonomy back to top
Eukaryota ⇒ Viridiplantae ⇒ Streptophyta ⇒ Embryophyta ⇒ Tracheophyta ⇒ Spermatophyta ⇒ Magnoliophyta ⇒ basal Magnoliophyta ⇒ Amborellales ⇒ Amborellaceae ⇒ Amborella.
Sequence Information back to top
Sequence length: 267
Substrate Binding Site: CNWN CVV: 441 CHI: -5.4
Selectivity Filter: LNMT CVV: 437 CHI: 1.5
Fasta sequence:
>tr|W1Q131|W1Q131_AMBTC|Unreviewed|Amborella_trichopoda|267
MAFIFAREDSYWSSSLFGGLLSGEFPNTITISDLHLLVGIIGNATAFLLYTAPMLTFRGV
IEKRSTEEFSCVPYIISLFNCLLYTWYGFPVVSDKWENITLLTINGFGVLLETSFIAIYF
WFAPRQKKRLVSFLVFAVLLVFLTTASISAFFIHDHPHRKALVGSVAVVASATMYSSPLV
AIGRVVQTQSVEFMPFYLSLFSFFTSSLWMAYGFLGNDLFIASPNFVGVPMAFLQLVVYY
TYRKKKEKAREYEEADVEQKVALLVKD
Snake diagram with key positions labelled

Modeled Structuresback to top
Model start: 28 Model end: 244
Alignment file: W1Q131.pir
Inward Open:
Template: 5CTG.pdb
Model structure: W1Q131_inward.pdb
Procheck score ⇒ Ramachandran plot: 93.8% favored 4.1% allowed 1.0% week 1.0% disallowed
Outward Open:
Template: 5CTG_outward.pdb
Model structure: W1Q131_outward.pdb
Procheck score ⇒ Ramachandran plot: 94.8% favored 4.6% allowed .0% week .5% disallowed
Occluded:
Template: 5CTG_occluded.pdb
Model structure: W1Q131_occluded.pdb
Procheck score ⇒ Ramachandran plot: 92.8% favored 6.2% allowed .5% week .5% disallowed
Gene Informationback to top
Gene ID: 18442367 Total Exons: 7 Coding Exons: 7
The diagram below shows the position of Exon-junctions in the protein structure ( Loops and transmembrane helices ).
If more than 1 exon translates a single secondary-structure , only the final exon is represented in figure.
Point on the red bars to view exon number







Gene Ontologyback to top
GO:0016021 - integral component of membrane
GO:0005886 - plasma membrane
GO:0008643 - carbohydrate transport
Family Classificationback to top
Pfam: PF03083: MtN3_slv.
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA