Basic Information |
Taxanomy |
Sequence Information |
Modeled Structures |
Gene Information |
Gene Ontology |
Family Classification |
Details : W1P3E6
dbSWEET id: dbswt_429
Accession: W1P3E6
Uniprot status: Unreviewed
Organism: Amborella trichopoda
Kingdom: Plantae
Taxonomy back to top
Eukaryota ⇒ Viridiplantae ⇒ Streptophyta ⇒ Embryophyta ⇒ Tracheophyta ⇒ Spermatophyta ⇒ Magnoliophyta ⇒ basal Magnoliophyta ⇒ Amborellales ⇒ Amborellaceae ⇒ Amborella.
Sequence Information back to top
Sequence length: 271
Substrate Binding Site: TNWN CVV: 448 CHI: -8.6
Selectivity Filter: VSMN CVV: 398 CHI: 1.8
Fasta sequence:
>tr|W1P3E6|W1P3E6_AMBTC|Unreviewed|Amborella_trichopoda|271
MEDLSFFFGILGNVISILVFASPIGTFQRVVKKKSTENFKGLPFVCTLLSTSLWSYYGLL
KPGGLLVLTVNGVGVAMEAIYVSLFLFYAPKNVKVKTAMLVLVLNVGFLGLVIMVTMLLL
HAPLRLQVVGFLSAALTLGMYASPMAVMRRVIVTKSVEYMPFFLFLNGGVWFLYSLLVGD
FFIGVPNGIGFILGATQLIVYAVYRNSKSTDQKPDMEELDTKHCFEIEMPRTDKNLEKAE
DNSIENVNLHKTSTGFTRGGEGETARARDEV
Snake diagram with key positions labelled
Modeled Structuresback to top
Model start: 1 Model end: 206
Alignment file: W1P3E6.pir
Inward Open:
Template: 5CTG.pdb
Model structure: W1P3E6_inward.pdb
Procheck score ⇒ Ramachandran plot: 94.9% favored 4.0% allowed .6% week .6% disallowed
Outward Open:
Template: 5CTG_outward.pdb
Model structure: W1P3E6_outward.pdb
Procheck score ⇒ Ramachandran plot: 92.6% favored 6.3% allowed 1.1% week .0% disallowed
Occluded:
Template: 5CTG_occluded.pdb
Model structure: W1P3E6_occluded.pdb
Procheck score ⇒ Ramachandran plot: 92.6% favored 5.1% allowed .6% week 1.7% disallowed
Gene Ontologyback to top
GO:0016021 - integral component of membrane
GO:0005886 - plasma membrane
GO:0008643 - carbohydrate transport
Family Classificationback to top
Pfam: PF03083: MtN3_slv.
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA