Basic Information |
Taxanomy |
Sequence Information |
Modeled Structures |
Gene Information |
Gene Ontology |
Family Classification |
Details : W0A0H7
dbSWEET id: dbswt_1957
Accession: W0A0H7
Uniprot status: Unreviewed
Organism: Aeromonas hydrophila
Kingdom: Bacteria
Taxonomy back to top
Bacteria ⇒ Proteobacteria ⇒ Gammaproteobacteria ⇒ Aeromonadales ⇒ Aeromonadaceae ⇒ Aeromonas.
Sequence Information back to top
Sequence length: 108
Substrate Binding Site: VNVN CVV: 402 CHI: 1.4
Selectivity Filter: SGSG CVV: 242 CHI: -2.4
Fasta sequence:
>tr|W0A0H7|W0A0H7_AERHY|Unreviewed|Aeromonas hydrophila| 108
MPPLFWPGAIALSLSLGGLVLWLDDAYLGLCAAFLTTGSFALQVVHILKTRETKAISLGM
YLAFSCGVLMWLVYGLKIDDMPVTIANSITLALASTVLLLKLRNERRT
Snake diagram with key positions labelled
Modeled Structuresback to top
Model start: 26 Model end: 103 Inward Open: Template: 4X5M.pdb Model structure: W0A0H7_inward.pdb Alignment file: W0A0H7_inw.pir Procheck score ⇒ Ramachandran plot: 92.0% favored 6.5% allowed .7% week .7% disallowed Outward Open: Template: 4X5N.pdb Model structure: W0A0H7_outward.pdb Alignment file: W0A0H7_out.pir Procheck score ⇒ Ramachandran plot: 92.0% favored 7.2% allowed .0% week .7% disallowed Occluded: Model structure: W0A0H7_occluded.pdb Alignment file: W0A0H7_occ.pir Procheck score ⇒ Ramachandran plot: 95.7% favored 4.3% allowed .0% week .0% disallowed
Family Classificationback to top
Pfam: PF03083: MtN3_slv
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA