Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : W0A0H7

dbSWEET id: dbswt_1957

Accession:   W0A0H7

Uniprot status:   Unreviewed

Organism:   Aeromonas hydrophila

Kingdom:   Bacteria

Taxonomy back to top


Bacteria ⇒ Proteobacteria ⇒ Gammaproteobacteria ⇒ Aeromonadales ⇒ Aeromonadaceae ⇒ Aeromonas.

Sequence Information back to top


Sequence length:   108

Substrate Binding Site:   VNVN           CVV:   402       CHI:   1.4

Selectivity Filter:   SGSG           CVV:   242       CHI:   -2.4

Fasta sequence:

>tr|W0A0H7|W0A0H7_AERHY|Unreviewed|Aeromonas hydrophila| 108
MPPLFWPGAIALSLSLGGLVLWLDDAYLGLCAAFLTTGSFALQVVHILKTRETKAISLGM
YLAFSCGVLMWLVYGLKIDDMPVTIANSITLALASTVLLLKLRNERRT

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   26     Model end:   103

Inward Open:

Template:   4X5M.pdb

Model structure:  W0A0H7_inward.pdb    Alignment file: W0A0H7_inw.pir

Procheck score ⇒ Ramachandran plot: 92.0% favored    6.5% allowed    .7% week    .7% disallowed

Outward Open:

Template:   4X5N.pdb

Model structure:  W0A0H7_outward.pdb    Alignment file: W0A0H7_out.pir

Procheck score ⇒ Ramachandran plot: 92.0% favored    7.2% allowed    .0% week    .7% disallowed

Occluded:

Template:   4QNC.pdb      4RNG.pdb

Model structure:  W0A0H7_occluded.pdb    Alignment file: W0A0H7_occ.pir

Procheck score ⇒ Ramachandran plot: 95.7% favored    4.3% allowed    .0% week    .0% disallowed

Gene Informationback to top


Not Available

Gene Ontologyback to top


GO:0016021 - integral component of membrane

Family Classificationback to top


Pfam:   PF03083: MtN3_slv 

Interpro:   IPR004316: SWEET_sugar_transpr. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur