Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : V9IFF2

dbSWEET id: dbswt_1250

Accession:   V9IFF2

Uniprot status:   Unreviewed

Organism:   Apis cerana

Kingdom:   Metazoa

Taxonomy back to top


Eukaryota ⇒ Metazoa ⇒ Ecdysozoa ⇒ Arthropoda ⇒ Hexapoda ⇒ Insecta ⇒ Pterygota ⇒ Neoptera ⇒ Endopterygota ⇒ Hymenoptera ⇒ Apocrita ⇒ Aculeata ⇒ Apoidea ⇒ Apidae ⇒ Apis.

Sequence Information back to top


Sequence length:   220

Substrate Binding Site:   CNWN           CVV:   441       CHI:   -5.4

Selectivity Filter:   QMLV           CVV:   467       CHI:   6.4

Fasta sequence:

>tr|V9IFF2|V9IFF2_APICE|Unreviewed|Apis_cerana|220
MGLEDYKELVASCASICTMGQMLSGTLICKDIYRKGSSEGFDSMPFLGGIGMCILMLQYA
WILKDIAMINVNIFGLLTNMAYMAVFYYYSPHTKDILASIGKATTFVMVFLAYAQVESPE
KIEFRFGLIVTVLLLLLVAFPLVHLRKIIETKNTDILPFPIIFMGTIVTFLWLLYGLIIN
NVFIIFQNSVAFVLSLAQMSLFVIYPSKSKNKESTQKKTE

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   1     Model end:   207

Alignment file: V9IFF2.pir

Inward Open:

Template:   5CTG.pdb

Model structure:  V9IFF2_inward.pdb

Procheck score ⇒ Ramachandran plot: 89.2% favored    8.6% allowed    .5% week    1.6% disallowed

Outward Open:

Template:   5CTG_outward.pdb

Model structure:  V9IFF2_outward.pdb

Procheck score ⇒ Ramachandran plot: 93.0% favored    5.4% allowed    1.6% week    .0% disallowed

Occluded:

Template:   5CTG_occluded.pdb

Model structure:  V9IFF2_occluded.pdb

Procheck score ⇒ Ramachandran plot: 90.8% favored    8.1% allowed    .5% week    .5% disallowed

Gene Informationback to top


Not Available

Gene Ontologyback to top


GO:0016021 - integral component of membrane

GO:0008643 - carbohydrate transport

Family Classificationback to top


Pfam:   PF03083: MtN3_slv 

Interpro:   IPR018178: SWEET_insect. IPR004316: SWEET_sugar_transpr. 

Panther:  PTHR10791:SF5

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur