| Basic Information |
| Taxanomy |
| Sequence Information |
| Modeled Structures |
| Gene Information |
| Gene Ontology |
| Family Classification |
Details : V9HKL1
dbSWEET id: dbswt_1956
Accession: V9HKL1
Uniprot status: Unreviewed
Organism: Simonsiella muelleri
Kingdom: Bacteria
Taxonomy back to top
Bacteria ⇒ Proteobacteria ⇒ Betaproteobacteria ⇒ Neisseriales ⇒ Neisseriaceae ⇒ Simonsiella.
Sequence Information back to top
Sequence length: 87
Substrate Binding Site: CNCN CVV: 364 CHI: -2
Selectivity Filter: SNSN CVV: 338 CHI: -8.6
Fasta sequence:
>tr|V9HKL1|V9HKL1_9NEIS|Unreviewed|Simonsiella muelleri|87
MKLTEKQINIVSIAATIMAVSMYVSYIPQIQANLAGHKGAPLQPLIAAINCTLWVVYGLI
KEKRDWAIVLANLPGIAFGLVTFATSF
Snake diagram with key positions labelled

Modeled Structuresback to top
Model start: 12 Model end: 88 Inward Open: Template: 4X5M.pdb Model structure: V9HKL1_inward.pdb Alignment file: V9HKL1_inw.pir Procheck score ⇒ Ramachandran plot: 92.3% favored 7.7% allowed .0% week .0% disallowed Outward Open: Template: 4X5N.pdb Model structure: V9HKL1_outward.pdb Alignment file: V9HKL1_out.pir Procheck score ⇒ Ramachandran plot: 93.8% favored 3.1% allowed 1.5% week 1.5% disallowed Occluded: Model structure: V9HKL1_occluded.pdb Alignment file: V9HKL1_occ.pir Procheck score ⇒ Ramachandran plot: 94.6% favored 5.4% allowed .0% week .0% disallowed
Family Classificationback to top
Pfam: PF03083: MtN3_slv
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA