Basic Information |
Taxanomy |
Sequence Information |
Modeled Structures |
Gene Information |
Gene Ontology |
Family Classification |
Details : V7IEY9
dbSWEET id: dbswt_1954
Accession: V7IEY9
Uniprot status: Unreviewed
Organism: Eikenella corrodens
Kingdom: Bacteria
Taxonomy back to top
Bacteria ⇒ Proteobacteria ⇒ Betaproteobacteria ⇒ Neisseriales ⇒ Neisseriaceae ⇒ Eikenella.
Sequence Information back to top
Sequence length: 88
Substrate Binding Site: CNCN CVV: 364 CHI: -2
Selectivity Filter: ASAS CVV: 280 CHI: 2
Fasta sequence:
>tr|V7IEY9|V7IEY9_EIKCO|Unreviewed|Eikenella corrodens|88
MISKKKFNTFIGSIGAAIGIFVFIAYIPQIIANLDGAKAQPWQPLFAAVSCLIWVLYGWS
KEPKKDWILIVPNAVGVILGSLTFLTAL
Snake diagram with key positions labelled
Modeled Structuresback to top
Model start: 12 Model end: 89 Inward Open: Template: 4X5M.pdb Model structure: V7IEY9_inward.pdb Alignment file: V7IEY9_inw.pir Procheck score ⇒ Ramachandran plot: 91.4% favored 7.8% allowed .8% week .0% disallowed Outward Open: Template: 4X5N.pdb Model structure: V7IEY9_outward.pdb Alignment file: V7IEY9_out.pir Procheck score ⇒ Ramachandran plot: 94.5% favored 4.7% allowed .0% week .8% disallowed Occluded: Model structure: V7IEY9_occluded.pdb Alignment file: V7IEY9_occ.pir Procheck score ⇒ Ramachandran plot: 89.8% favored 7.8% allowed .8% week 1.6% disallowed
Family Classificationback to top
Pfam: PF03083: MtN3_slv
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA