Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : V7CRU0

dbSWEET id: dbswt_407

Accession:   V7CRU0

Uniprot status:   Unreviewed

Organism:   Phaseolus vulgaris

Kingdom:   Plantae

Taxonomy back to top


Eukaryota ⇒ Viridiplantae ⇒ Streptophyta ⇒ Embryophyta ⇒ Tracheophyta ⇒ Spermatophyta ⇒ Magnoliophyta ⇒ eudicotyledons ⇒ Gunneridae ⇒ Pentapetalae ⇒ rosids ⇒ fabids ⇒ Fabales ⇒ Fabaceae ⇒ Papilionoideae ⇒ Phaseoleae ⇒ Phaseolus.

Sequence Information back to top


Sequence length:   304

Substrate Binding Site:   SNWN           CVV:   428       CHI:   -8.7

Selectivity Filter:   CTVS           CVV:   357       CHI:   5.2

Fasta sequence:

>tr|V7CRU0|V7CRU0_PHAVU|Unreviewed|Phaseolus_vulgaris|304
MANDAPYVFAVGILGNLVSFCCFLAPVPTFYRVCKKKTTESFQSLPYVAALFTSMLWIFY
AYIKTGEILLITINAFGCFIETVYLIIYITYCPKKARYFTFKMIFLFNVGVIFLVVLLTH
VLAKERTARIELLGWICVVLSTSVFAAPLSIIKVVIRTKSVEFMPITLSVLLTVSAIMWM
AYGILLRDIYVTLPNFVGITFGTIQIVLYFIYRKHKPVKDQKLAEHKDNVTNEENANTAV
RSVNQGANAVAFVDVEFGEKKEVKKVEEAEKKQDQVGNSRDRTEHNNNSNKTREASTQLQ
HREG

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   1     Model end:   214

Alignment file: V7CRU0.pir

Inward Open:

Template:   5CTG.pdb

Model structure:  V7CRU0_inward.pdb

Procheck score ⇒ Ramachandran plot: 92.3% favored    5.2% allowed    1.0% week    1.5% disallowed

Outward Open:

Template:   5CTG_outward.pdb

Model structure:  V7CRU0_outward.pdb

Procheck score ⇒ Ramachandran plot: 91.8% favored    6.2% allowed    2.1% week    .0% disallowed

Occluded:

Template:   5CTG_occluded.pdb

Model structure:  V7CRU0_occluded.pdb

Procheck score ⇒ Ramachandran plot: 91.8% favored    6.2% allowed    1.5% week    .5% disallowed

Gene Informationback to top


Gene ID:   18639392     Total Exons:   6     Coding Exons:   6

The diagram below shows the position of Exon-junctions in the protein structure ( Loops and transmembrane helices ).

If more than 1 exon translates a single secondary-structure , only the final exon is represented in figure.
Point on the red bars to view exon number

Gene Ontologyback to top


GO:0016021 - integral component of membrane

GO:0005886 - plasma membrane

GO:0008643 - carbohydrate transport

Family Classificationback to top


Pfam:   PF03083: MtN3_slv. 

Interpro:   IPR018179: SWEET10-like. IPR004316: SWEET_sugar_transpr. 

Panther:  PTHR10791:SF22

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur