Basic Information |
Taxanomy |
Sequence Information |
Modeled Structures |
Gene Information |
Gene Ontology |
Family Classification |
Details : V7BV59
dbSWEET id: dbswt_111
Accession: V7BV59
Uniprot status: Unreviewed
Organism: Phaseolus vulgaris
Kingdom: Plantae
Taxonomy back to top
Eukaryota ⇒ Viridiplantae ⇒ Streptophyta ⇒ Embryophyta ⇒ Tracheophyta ⇒ Spermatophyta ⇒ Magnoliophyta ⇒ eudicotyledons ⇒ Gunneridae ⇒ Pentapetalae ⇒ rosids ⇒ fabids ⇒ Fabales ⇒ Fabaceae ⇒ Papilionoideae ⇒ Phaseoleae ⇒ Phaseolus.
Sequence Information back to top
Sequence length: 273
Substrate Binding Site: SNWN CVV: 428 CHI: -8.7
Selectivity Filter: VSVN CVV: 379 CHI: 4.1
Fasta sequence:
>tr|V7BV59|V7BV59_PHAVU|Unreviewed|Phaseolus_vulgaris|273
MAILGSHNPWAAAFGILGNIISLMVYLAPAHTFYRIYKKKCTEGFQSLPYLVALFSSSLW
LYYASFNIKHSVFLITINSLGCVIEIVYIVIFIKYAHKDAKNLTIKLVAAMNLGSLALIL
LVTHFALNASLQVKVIGWICDIVSLSVFAAPLSIMAQVVRTKSVQFMPFSLSFSLTLNAI
MWLAYGLFNKDNCVALPNVGGVALGLLQMVLYAIYRNCGARELATEGGMRTIVVVNPLGP
AEVFPIAENDEVNDEVAEDHAQEKTVEAIDCPL
Snake diagram with key positions labelled
Modeled Structuresback to top
Model start: 4 Model end: 217
Alignment file: V7BV59.pir
Inward Open:
Template: 5CTG.pdb
Model structure: V7BV59_inward.pdb
Procheck score ⇒ Ramachandran plot: 93.8% favored 4.1% allowed 1.0% week 1.0% disallowed
Outward Open:
Template: 5CTG_outward.pdb
Model structure: V7BV59_outward.pdb
Procheck score ⇒ Ramachandran plot: 95.9% favored 3.1% allowed 1.0% week .0% disallowed
Occluded:
Template: 5CTG_occluded.pdb
Model structure: V7BV59_occluded.pdb
Procheck score ⇒ Ramachandran plot: 92.3% favored 7.2% allowed .5% week .0% disallowed
Gene Informationback to top
Gene ID: 18629482 Total Exons: 6 Coding Exons: 6
The diagram below shows the position of Exon-junctions in the protein structure ( Loops and transmembrane helices ).
If more than 1 exon translates a single secondary-structure , only the final exon is represented in figure.
Point on the red bars to view exon number
Gene Ontologyback to top
GO:0016021 - integral component of membrane
GO:0005886 - plasma membrane
GO:0008643 - carbohydrate transport
Family Classificationback to top
Pfam: PF03083: MtN3_slv.
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA