| Basic Information |
| Taxanomy |
| Sequence Information |
| Modeled Structures |
| Gene Information |
| Gene Ontology |
| Family Classification |
Details : V7B2T4
dbSWEET id: dbswt_259
Accession: V7B2T4
Uniprot status: Unreviewed
Organism: Phaseolus vulgaris
Kingdom: Plantae
Taxonomy back to top
Eukaryota ⇒ Viridiplantae ⇒ Streptophyta ⇒ Embryophyta ⇒ Tracheophyta ⇒ Spermatophyta ⇒ Magnoliophyta ⇒ eudicotyledons ⇒ Gunneridae ⇒ Pentapetalae ⇒ rosids ⇒ fabids ⇒ Fabales ⇒ Fabaceae ⇒ Papilionoideae ⇒ Phaseoleae ⇒ Phaseolus.
Sequence Information back to top
Sequence length: 259
Substrate Binding Site: ANWN CVV: 422 CHI: -6.1
Selectivity Filter: VSVC CVV: 369 CHI: 10.1
Fasta sequence:
>tr|V7B2T4|V7B2T4_PHAVU|Unreviewed|Phaseolus_vulgaris|259
MVSFSDHEMVLIFGLLGNIVSFLVFLAPLPTFYKIYKNKSSEGFQSIPYVVALLSALLLL
YYGFIKTNALLIVTINCIGCVIEVTYLAMYIIYAHKKQKISTLVMILIADVGGFGLTMLI
STFAVKGIARVHAVGWICAIFNIAVFAAPLSIMRKVIKTKSVEYMPFSLSLFLTLCATMW
FFYGLFDKDEFIMLPNVLGFLFGISQMILYIIYKNVGKNTKTNCAEQQESEGTKQHSCGD
NKLDFPSVVEMKENQLNQV
Snake diagram with key positions labelled

Modeled Structuresback to top
Model start: 3 Model end: 215
Alignment file: V7B2T4.pir
Inward Open:
Template: 5CTG.pdb
Model structure: V7B2T4_inward.pdb
Procheck score ⇒ Ramachandran plot: 94.8% favored 2.1% allowed 2.1% week 1.0% disallowed
Outward Open:
Template: 5CTG_outward.pdb
Model structure: V7B2T4_outward.pdb
Procheck score ⇒ Ramachandran plot: 93.2% favored 5.8% allowed .5% week .5% disallowed
Occluded:
Template: 5CTG_occluded.pdb
Model structure: V7B2T4_occluded.pdb
Procheck score ⇒ Ramachandran plot: 92.1% favored 7.3% allowed .5% week .0% disallowed
Gene Informationback to top
Gene ID: 18621460 Total Exons: 6 Coding Exons: 6
The diagram below shows the position of Exon-junctions in the protein structure ( Loops and transmembrane helices ).
If more than 1 exon translates a single secondary-structure , only the final exon is represented in figure.
Point on the red bars to view exon number






Gene Ontologyback to top
GO:0016021 - integral component of membrane
GO:0005886 - plasma membrane
GO:0008643 - carbohydrate transport
Family Classificationback to top
Pfam: PF03083: MtN3_slv.
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA