Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : V7B2T4

dbSWEET id: dbswt_259

Accession:   V7B2T4

Uniprot status:   Unreviewed

Organism:   Phaseolus vulgaris

Kingdom:   Plantae

Taxonomy back to top


Eukaryota ⇒ Viridiplantae ⇒ Streptophyta ⇒ Embryophyta ⇒ Tracheophyta ⇒ Spermatophyta ⇒ Magnoliophyta ⇒ eudicotyledons ⇒ Gunneridae ⇒ Pentapetalae ⇒ rosids ⇒ fabids ⇒ Fabales ⇒ Fabaceae ⇒ Papilionoideae ⇒ Phaseoleae ⇒ Phaseolus.

Sequence Information back to top


Sequence length:   259

Substrate Binding Site:   ANWN           CVV:   422       CHI:   -6.1

Selectivity Filter:   VSVC           CVV:   369       CHI:   10.1

Fasta sequence:

>tr|V7B2T4|V7B2T4_PHAVU|Unreviewed|Phaseolus_vulgaris|259
MVSFSDHEMVLIFGLLGNIVSFLVFLAPLPTFYKIYKNKSSEGFQSIPYVVALLSALLLL
YYGFIKTNALLIVTINCIGCVIEVTYLAMYIIYAHKKQKISTLVMILIADVGGFGLTMLI
STFAVKGIARVHAVGWICAIFNIAVFAAPLSIMRKVIKTKSVEYMPFSLSLFLTLCATMW
FFYGLFDKDEFIMLPNVLGFLFGISQMILYIIYKNVGKNTKTNCAEQQESEGTKQHSCGD
NKLDFPSVVEMKENQLNQV

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   3     Model end:   215

Alignment file: V7B2T4.pir

Inward Open:

Template:   5CTG.pdb

Model structure:  V7B2T4_inward.pdb

Procheck score ⇒ Ramachandran plot: 94.8% favored    2.1% allowed    2.1% week    1.0% disallowed

Outward Open:

Template:   5CTG_outward.pdb

Model structure:  V7B2T4_outward.pdb

Procheck score ⇒ Ramachandran plot: 93.2% favored    5.8% allowed    .5% week    .5% disallowed

Occluded:

Template:   5CTG_occluded.pdb

Model structure:  V7B2T4_occluded.pdb

Procheck score ⇒ Ramachandran plot: 92.1% favored    7.3% allowed    .5% week    .0% disallowed

Gene Informationback to top


Gene ID:   18621460     Total Exons:   6     Coding Exons:   6

The diagram below shows the position of Exon-junctions in the protein structure ( Loops and transmembrane helices ).

If more than 1 exon translates a single secondary-structure , only the final exon is represented in figure.
Point on the red bars to view exon number

Gene Ontologyback to top


GO:0016021 - integral component of membrane

GO:0005886 - plasma membrane

GO:0008643 - carbohydrate transport

Family Classificationback to top


Pfam:   PF03083: MtN3_slv. 

Interpro:   IPR004316: SWEET_sugar_transpr. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur