| Basic Information |
| Taxanomy |
| Sequence Information |
| Modeled Structures |
| Gene Information |
| Gene Ontology |
| Family Classification |
Details : V7B2I1
dbSWEET id: dbswt_127
Accession: V7B2I1
Uniprot status: Unreviewed
Organism: Phaseolus vulgaris
Kingdom: Plantae
Taxonomy back to top
Eukaryota ⇒ Viridiplantae ⇒ Streptophyta ⇒ Embryophyta ⇒ Tracheophyta ⇒ Spermatophyta ⇒ Magnoliophyta ⇒ eudicotyledons ⇒ Gunneridae ⇒ Pentapetalae ⇒ rosids ⇒ fabids ⇒ Fabales ⇒ Fabaceae ⇒ Papilionoideae ⇒ Phaseoleae ⇒ Phaseolus.
Sequence Information back to top
Sequence length: 270
Substrate Binding Site: SNWN CVV: 428 CHI: -8.7
Selectivity Filter: VSVS CVV: 356 CHI: 6.8
Fasta sequence:
>tr|V7B2I1|V7B2I1_PHAVU|Unreviewed|Phaseolus_vulgaris|270
MIITHHTLAFTFGMLGNVISFLVFLAPVPTFYRIYKKKSTESFQSLPYLVALFSSMLWLY
YAWLKKDAVLLITINLFGCVIEIIYIILYIIYATRDARNLTIKLFSAMNLGSFALILVVT
NFIVHGPLRVQVLGWICVSVSVSVFAAPLSIVAQVVRTKSVEFMPFNLSFTLTLSAIMWF
GYGLFLKDICIALPNVLGFVLGLLQMLLYTIYRKGNKKGNTMEKNPQEPLKNIVVASPMG
TGEVFPVEEDEEAKKSQVEREEKKSEECVV
Snake diagram with key positions labelled

Modeled Structuresback to top
Model start: 2 Model end: 214
Alignment file: V7B2I1.pir
Inward Open:
Template: 5CTG.pdb
Model structure: V7B2I1_inward.pdb
Procheck score ⇒ Ramachandran plot: 91.7% favored 7.3% allowed .5% week .5% disallowed
Outward Open:
Template: 5CTG_outward.pdb
Model structure: V7B2I1_outward.pdb
Procheck score ⇒ Ramachandran plot: 92.7% favored 6.2% allowed .5% week .5% disallowed
Occluded:
Template: 5CTG_occluded.pdb
Model structure: V7B2I1_occluded.pdb
Procheck score ⇒ Ramachandran plot: 92.2% favored 5.7% allowed 1.6% week .5% disallowed
Gene Informationback to top
Gene ID: 18621411 Total Exons: 6 Coding Exons: 6
The diagram below shows the position of Exon-junctions in the protein structure ( Loops and transmembrane helices ).
If more than 1 exon translates a single secondary-structure , only the final exon is represented in figure.
Point on the red bars to view exon number






Gene Ontologyback to top
GO:0016021 - integral component of membrane
GO:0005886 - plasma membrane
GO:0008643 - carbohydrate transport
Family Classificationback to top
Pfam: PF03083: MtN3_slv.
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA