Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : V7B050

dbSWEET id: dbswt_405

Accession:   V7B050

Uniprot status:   Unreviewed

Organism:   Phaseolus vulgaris

Kingdom:   Plantae

Taxonomy back to top


Eukaryota ⇒ Viridiplantae ⇒ Streptophyta ⇒ Embryophyta ⇒ Tracheophyta ⇒ Spermatophyta ⇒ Magnoliophyta ⇒ eudicotyledons ⇒ Gunneridae ⇒ Pentapetalae ⇒ rosids ⇒ fabids ⇒ Fabales ⇒ Fabaceae ⇒ Papilionoideae ⇒ Phaseoleae ⇒ Phaseolus.

Sequence Information back to top


Sequence length:   291

Substrate Binding Site:   ANWN           CVV:   422       CHI:   -6.1

Selectivity Filter:   CSVS           CVV:   337       CHI:   5.1

Fasta sequence:

>tr|V7B050|V7B050_PHAVU|Unreviewed|Phaseolus_vulgaris|291
MSHSPLSFLFGVLGNVASFVCFLAPLPTFYRVCKKKSTEGFQSVPYVAALFSAMLWIFYA
YVKTGETLLITINSFGCVIETIYLAIFLTYCPKKARMSTLRMIVLFNFGGFCTIVLLTHL
LAKGAGRVKLLGWICVVFATSVFAAPLSIIRVVIRTKSVEFLPFPLSMLLLLSAIMWLLY
GISLKDIYVTLPNVVGLTFGVIQIVLYMMYRNNKTLKNEKLPEHKGDIDNNENVAPTVSA
ENQEQEVNPQAGVVEIGEKKEDQLDEEKPDKTELNNNNSNNKKTEEESSEV

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   1     Model end:   212

Alignment file: V7B050.pir

Inward Open:

Template:   5CTG.pdb

Model structure:  V7B050_inward.pdb

Procheck score ⇒ Ramachandran plot: 95.7% favored    2.7% allowed    1.6% week    .0% disallowed

Outward Open:

Template:   5CTG_outward.pdb

Model structure:  V7B050_outward.pdb

Procheck score ⇒ Ramachandran plot: 92.5% favored    4.8% allowed    1.1% week    1.6% disallowed

Occluded:

Template:   5CTG_occluded.pdb

Model structure:  V7B050_occluded.pdb

Procheck score ⇒ Ramachandran plot: 93.6% favored    4.3% allowed    1.1% week    1.1% disallowed

Gene Informationback to top


Gene ID:   18620346     Total Exons:   6     Coding Exons:   6

The diagram below shows the position of Exon-junctions in the protein structure ( Loops and transmembrane helices ).

If more than 1 exon translates a single secondary-structure , only the final exon is represented in figure.
Point on the red bars to view exon number

Gene Ontologyback to top


GO:0016021 - integral component of membrane

GO:0005886 - plasma membrane

GO:0008643 - carbohydrate transport

Family Classificationback to top


Pfam:   PF03083: MtN3_slv. 

Interpro:   IPR018179: SWEET10-like. IPR004316: SWEET_sugar_transpr. 

Panther:  PTHR10791:SF22

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur