Basic Information |
Taxanomy |
Sequence Information |
Modeled Structures |
Gene Information |
Gene Ontology |
Family Classification |
Details : V7AZ44
dbSWEET id: dbswt_497
Accession: V7AZ44
Uniprot status: Unreviewed
Organism: Phaseolus vulgaris
Kingdom: Plantae
Taxonomy back to top
Eukaryota ⇒ Viridiplantae ⇒ Streptophyta ⇒ Embryophyta ⇒ Tracheophyta ⇒ Spermatophyta ⇒ Magnoliophyta ⇒ eudicotyledons ⇒ Gunneridae ⇒ Pentapetalae ⇒ rosids ⇒ fabids ⇒ Fabales ⇒ Fabaceae ⇒ Papilionoideae ⇒ Phaseoleae ⇒ Phaseolus.
Sequence Information back to top
Sequence length: 245
Substrate Binding Site: CNWN CVV: 441 CHI: -5.4
Selectivity Filter: MNMN CVV: 440 CHI: -3.2
Fasta sequence:
>tr|V7AZ44|V7AZ44_PHAVU|Unreviewed|Phaseolus_vulgaris|245
MEDASFIFGVIGNIISILMFLSPVPTFWKIIKQKSTEDFSSLPYICTLLNCSLWTYYGTI
KPGEYLVATVNGFGILVEIIYIILFLIYAQKSIRVRTAILAVILDVVIFAAAVATTLLAL
QGDGRSGAVGVMGAGLNIVMYSSPLSVMKTVVTTKSVEYMPFLLSFFFFLNGGVWLLYAV
LVRDVILGVPNGTGFLLGAMQLGLYCIYRNGGRKVSEKRLEEGMQHEPLISQPNNQSHQR
EHWAT
Snake diagram with key positions labelled
Modeled Structuresback to top
Model start: 1 Model end: 210
Alignment file: V7AZ44.pir
Inward Open:
Template: 5CTG.pdb
Model structure: V7AZ44_inward.pdb
Procheck score ⇒ Ramachandran plot: 93.9% favored 5.0% allowed .6% week .6% disallowed
Outward Open:
Template: 5CTG_outward.pdb
Model structure: V7AZ44_outward.pdb
Procheck score ⇒ Ramachandran plot: 92.8% favored 5.5% allowed .6% week 1.1% disallowed
Occluded:
Template: 5CTG_occluded.pdb
Model structure: V7AZ44_occluded.pdb
Procheck score ⇒ Ramachandran plot: 94.5% favored 3.9% allowed .6% week 1.1% disallowed
Gene Informationback to top
Gene ID: 18621245 Total Exons: 6 Coding Exons: 6
The diagram below shows the position of Exon-junctions in the protein structure ( Loops and transmembrane helices ).
If more than 1 exon translates a single secondary-structure , only the final exon is represented in figure.
Point on the red bars to view exon number
Gene Ontologyback to top
GO:0016021 - integral component of membrane
GO:0005886 - plasma membrane
GO:0008643 - carbohydrate transport
Family Classificationback to top
Pfam: PF03083: MtN3_slv.
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA