| Basic Information |
| Taxanomy |
| Sequence Information |
| Modeled Structures |
| Gene Information |
| Gene Ontology |
| Family Classification |
Details : V7AWB5
dbSWEET id: dbswt_177
Accession: V7AWB5
Uniprot status: Unreviewed
Organism: Phaseolus vulgaris
Kingdom: Plantae
Taxonomy back to top
Eukaryota ⇒ Viridiplantae ⇒ Streptophyta ⇒ Embryophyta ⇒ Tracheophyta ⇒ Spermatophyta ⇒ Magnoliophyta ⇒ eudicotyledons ⇒ Gunneridae ⇒ Pentapetalae ⇒ rosids ⇒ fabids ⇒ Fabales ⇒ Fabaceae ⇒ Papilionoideae ⇒ Phaseoleae ⇒ Phaseolus.
Sequence Information back to top
Sequence length: 264
Substrate Binding Site: SNWN CVV: 428 CHI: -8.7
Selectivity Filter: VSVN CVV: 379 CHI: 4.1
Fasta sequence:
>tr|V7AWB5|V7AWB5_PHAVU|Unreviewed|Phaseolus_vulgaris|264
MAIHHETWAFVFGLLGNVISFMVFLAPLPTFYQIYKKKTAEGFQSLPYVVALFSSMLWIY
YALVKKDASLLLITINSFGCVIESIYLAIFLLYAPSKTRLCTIKLLLLLNVFGFGAMLLS
TLYFTTGSKRLSVIGWICLVFNISVFAAPLCIMKRVIKTKSVEYMPFSLSFFLTINAVMW
FFYGLLLKDYYIALPNTLGFLFGIIQMMLYLVYRNAKPKTLEEPTKLQELNGHIVDVVKL
GTMAPSEPNHVTKSGAVTETATNV
Snake diagram with key positions labelled

Modeled Structuresback to top
Model start: 2 Model end: 215
Alignment file: V7AWB5.pir
Inward Open:
Template: 5CTG.pdb
Model structure: V7AWB5_inward.pdb
Procheck score ⇒ Ramachandran plot: 91.7% favored 4.7% allowed 2.6% week 1.0% disallowed
Outward Open:
Template: 5CTG_outward.pdb
Model structure: V7AWB5_outward.pdb
Procheck score ⇒ Ramachandran plot: 91.7% favored 7.3% allowed 1.0% week .0% disallowed
Occluded:
Template: 5CTG_occluded.pdb
Model structure: V7AWB5_occluded.pdb
Procheck score ⇒ Ramachandran plot: 93.3% favored 5.2% allowed 1.0% week .5% disallowed
Gene Informationback to top
Gene ID: 18620344 Total Exons: 6 Coding Exons: 6
The diagram below shows the position of Exon-junctions in the protein structure ( Loops and transmembrane helices ).
If more than 1 exon translates a single secondary-structure , only the final exon is represented in figure.
Point on the red bars to view exon number






Gene Ontologyback to top
GO:0016021 - integral component of membrane
GO:0005886 - plasma membrane
GO:0008643 - carbohydrate transport
Family Classificationback to top
Pfam: PF03083: MtN3_slv.
Interpro: IPR018179: SWEET10-like. IPR004316: SWEET_sugar_transpr.
Panther: PTHR10791:SF22