Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : V7AWB5

dbSWEET id: dbswt_177

Accession:   V7AWB5

Uniprot status:   Unreviewed

Organism:   Phaseolus vulgaris

Kingdom:   Plantae

Taxonomy back to top


Eukaryota ⇒ Viridiplantae ⇒ Streptophyta ⇒ Embryophyta ⇒ Tracheophyta ⇒ Spermatophyta ⇒ Magnoliophyta ⇒ eudicotyledons ⇒ Gunneridae ⇒ Pentapetalae ⇒ rosids ⇒ fabids ⇒ Fabales ⇒ Fabaceae ⇒ Papilionoideae ⇒ Phaseoleae ⇒ Phaseolus.

Sequence Information back to top


Sequence length:   264

Substrate Binding Site:   SNWN           CVV:   428       CHI:   -8.7

Selectivity Filter:   VSVN           CVV:   379       CHI:   4.1

Fasta sequence:

>tr|V7AWB5|V7AWB5_PHAVU|Unreviewed|Phaseolus_vulgaris|264
MAIHHETWAFVFGLLGNVISFMVFLAPLPTFYQIYKKKTAEGFQSLPYVVALFSSMLWIY
YALVKKDASLLLITINSFGCVIESIYLAIFLLYAPSKTRLCTIKLLLLLNVFGFGAMLLS
TLYFTTGSKRLSVIGWICLVFNISVFAAPLCIMKRVIKTKSVEYMPFSLSFFLTINAVMW
FFYGLLLKDYYIALPNTLGFLFGIIQMMLYLVYRNAKPKTLEEPTKLQELNGHIVDVVKL
GTMAPSEPNHVTKSGAVTETATNV

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   2     Model end:   215

Alignment file: V7AWB5.pir

Inward Open:

Template:   5CTG.pdb

Model structure:  V7AWB5_inward.pdb

Procheck score ⇒ Ramachandran plot: 91.7% favored    4.7% allowed    2.6% week    1.0% disallowed

Outward Open:

Template:   5CTG_outward.pdb

Model structure:  V7AWB5_outward.pdb

Procheck score ⇒ Ramachandran plot: 91.7% favored    7.3% allowed    1.0% week    .0% disallowed

Occluded:

Template:   5CTG_occluded.pdb

Model structure:  V7AWB5_occluded.pdb

Procheck score ⇒ Ramachandran plot: 93.3% favored    5.2% allowed    1.0% week    .5% disallowed

Gene Informationback to top


Gene ID:   18620344     Total Exons:   6     Coding Exons:   6

The diagram below shows the position of Exon-junctions in the protein structure ( Loops and transmembrane helices ).

If more than 1 exon translates a single secondary-structure , only the final exon is represented in figure.
Point on the red bars to view exon number

Gene Ontologyback to top


GO:0016021 - integral component of membrane

GO:0005886 - plasma membrane

GO:0008643 - carbohydrate transport

Family Classificationback to top


Pfam:   PF03083: MtN3_slv. 

Interpro:   IPR018179: SWEET10-like. IPR004316: SWEET_sugar_transpr. 

Panther:  PTHR10791:SF22

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur