| Basic Information |
| Taxanomy |
| Sequence Information |
| Modeled Structures |
| Gene Information |
| Gene Ontology |
| Family Classification |
Details : V7AW98
dbSWEET id: dbswt_558
Accession: V7AW98
Uniprot status: Unreviewed
Organism: Phaseolus vulgaris
Kingdom: Plantae
Taxonomy back to top
Eukaryota ⇒ Viridiplantae ⇒ Streptophyta ⇒ Embryophyta ⇒ Tracheophyta ⇒ Spermatophyta ⇒ Magnoliophyta ⇒ eudicotyledons ⇒ Gunneridae ⇒ Pentapetalae ⇒ rosids ⇒ fabids ⇒ Fabales ⇒ Fabaceae ⇒ Papilionoideae ⇒ Phaseoleae ⇒ Phaseolus.
Sequence Information back to top
Sequence length: 254
Substrate Binding Site: CNWS CVV: 418 CHI: -2.7
Selectivity Filter: LNLS CVV: 417 CHI: 3.3
Fasta sequence:
>tr|V7AW98|V7AW98_PHAVU|Unreviewed|Phaseolus_vulgaris|254
MAETIRMLIAVFGNAASMSLYAAPMVTFRRIIRKKSTEEFSCIPYIIGLLNCLLYTWYGL
PVVSCKWENFPIVTVNGVGIVLELSYVLIYFWFTSSKGKVKVAMTAIPVVLVFCITAAVS
AFAFHDNRHRKILVGSIGLVVSVTLYGSPLVAMKKVIQTKSVEFMPITLSVCSFFSSTLW
LIYGLLIRDIFVAGPSVLGTPLSILQLVLYCKYRKGSVVEEPSKGDQEKGNLEKVDMEMG
KVETNVTNHMNENL
Snake diagram with key positions labelled

Modeled Structuresback to top
Model start: 1 Model end: 215
Alignment file: V7AW98.pir
Inward Open:
Template: 5CTG.pdb
Model structure: V7AW98_inward.pdb
Procheck score ⇒ Ramachandran plot: 93.2% favored 4.2% allowed 1.0% week 1.6% disallowed
Outward Open:
Template: 5CTG_outward.pdb
Model structure: V7AW98_outward.pdb
Procheck score ⇒ Ramachandran plot: 91.1% favored 7.9% allowed 1.0% week .0% disallowed
Occluded:
Template: 5CTG_occluded.pdb
Model structure: V7AW98_occluded.pdb
Procheck score ⇒ Ramachandran plot: 88.0% favored 8.4% allowed 2.1% week 1.6% disallowed
Gene Informationback to top
Gene ID: 18620088 Total Exons: 6 Coding Exons: 6
The diagram below shows the position of Exon-junctions in the protein structure ( Loops and transmembrane helices ).
If more than 1 exon translates a single secondary-structure , only the final exon is represented in figure.
Point on the red bars to view exon number






Gene Ontologyback to top
GO:0016021 - integral component of membrane
GO:0005886 - plasma membrane
GO:0008643 - carbohydrate transport
Family Classificationback to top
Pfam: PF03083: MtN3_slv.
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA