| Basic Information |
| Taxanomy |
| Sequence Information |
| Modeled Structures |
| Gene Information |
| Gene Ontology |
| Family Classification |
Details : V6HZX4
dbSWEET id: dbswt_1953
Accession: V6HZX4
Uniprot status: Unreviewed
Organism: Leptospira alexanderi
Kingdom: Bacteria
Sequence Information back to top
Sequence length: 88
Substrate Binding Site: VNVN CVV: 402 CHI: 1.4
Selectivity Filter: SGSG CVV: 242 CHI: -2.4
Fasta sequence:
>tr|V6HZX4|V6HZX4_9LEPT|Unreviewed|Leptospira alexanderi|88
MDSITFLGYIASLLTTVSFLPQLIRIVMGGSTKDISRNMYIVLVTGVVLWFVYGCLKQDF
PIILANAVTFIFTLSILYFKLKNDSKGE
Snake diagram with key positions labelled

Modeled Structuresback to top
Model start: 5 Model end: 82 Inward Open: Template: 4X5M.pdb Model structure: V6HZX4_inward.pdb Alignment file: V6HZX4_inw.pir Procheck score ⇒ Ramachandran plot: 96.3% favored 2.2% allowed 1.5% week .0% disallowed Outward Open: Template: 4X5N.pdb Model structure: V6HZX4_outward.pdb Alignment file: V6HZX4_out.pir Procheck score ⇒ Ramachandran plot: 97.8% favored 2.2% allowed .0% week .0% disallowed Occluded: Model structure: V6HZX4_occluded.pdb Alignment file: V6HZX4_occ.pir Procheck score ⇒ Ramachandran plot: 97.8% favored 2.2% allowed .0% week .0% disallowed
Family Classificationback to top
Pfam: PF03083: MtN3_slv
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA