Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : V6HZX4

dbSWEET id: dbswt_1953

Accession:   V6HZX4

Uniprot status:   Unreviewed

Organism:   Leptospira alexanderi

Kingdom:   Bacteria

Taxonomy back to top


Bacteria ⇒ Spirochaetes ⇒ Leptospirales ⇒ Leptospiraceae ⇒ Leptospira.

Sequence Information back to top


Sequence length:   88

Substrate Binding Site:   VNVN           CVV:   402       CHI:   1.4

Selectivity Filter:   SGSG           CVV:   242       CHI:   -2.4

Fasta sequence:

>tr|V6HZX4|V6HZX4_9LEPT|Unreviewed|Leptospira alexanderi|88
MDSITFLGYIASLLTTVSFLPQLIRIVMGGSTKDISRNMYIVLVTGVVLWFVYGCLKQDF
PIILANAVTFIFTLSILYFKLKNDSKGE

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   5     Model end:   82

Inward Open:

Template:   4X5M.pdb

Model structure:  V6HZX4_inward.pdb    Alignment file: V6HZX4_inw.pir

Procheck score ⇒ Ramachandran plot: 96.3% favored    2.2% allowed    1.5% week    .0% disallowed

Outward Open:

Template:   4X5N.pdb

Model structure:  V6HZX4_outward.pdb    Alignment file: V6HZX4_out.pir

Procheck score ⇒ Ramachandran plot: 97.8% favored    2.2% allowed    .0% week    .0% disallowed

Occluded:

Template:   4QNC.pdb      4RNG.pdb

Model structure:  V6HZX4_occluded.pdb    Alignment file: V6HZX4_occ.pir

Procheck score ⇒ Ramachandran plot: 97.8% favored    2.2% allowed    .0% week    .0% disallowed

Gene Informationback to top


Not Available

Gene Ontologyback to top


GO:0016021 - integral component of membrane

Family Classificationback to top


Pfam:   PF03083: MtN3_slv 

Interpro:   IPR004316: SWEET_sugar_transpr. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur