Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : V5P2V2

dbSWEET id: dbswt_1951

Accession:   V5P2V2

Uniprot status:   Unreviewed

Organism:   Lactobacillus johnsonii

Kingdom:   Bacteria

Taxonomy back to top


Bacteria ⇒ Firmicutes ⇒ Bacilli ⇒ Lactobacillales ⇒ Lactobacillaceae ⇒ Lactobacillus.

Sequence Information back to top


Sequence length:   93

Substrate Binding Site:   CNCN           CVV:   364       CHI:   -2

Selectivity Filter:   SNSN           CVV:   338       CHI:   -8.6

Fasta sequence:

>tr|V5P2V2|V5P2V2_LACJH|Unreviewed|Lactobacillus johnsonii|93
MKKKIRSFDNKTVLMIGRIGSVLSVLMYISYIPQIMNNLQGNYGNPIQPLVAAINCFIWV
LYALLREKKDWPLFVANFPGILFGLATFITSLH

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   17     Model end:   93

Inward Open:

Template:   4X5M.pdb

Model structure:  V5P2V2_inward.pdb    Alignment file: V5P2V2_inw.pir

Procheck score ⇒ Ramachandran plot: 88.3% favored    9.4% allowed    2.3% week    .0% disallowed

Outward Open:

Template:   4X5N.pdb

Model structure:  V5P2V2_outward.pdb    Alignment file: V5P2V2_out.pir

Procheck score ⇒ Ramachandran plot: 89.8% favored    8.6% allowed    1.6% week    .0% disallowed

Occluded:

Template:   4QNC.pdb      4RNG.pdb

Model structure:  V5P2V2_occluded.pdb    Alignment file: V5P2V2_occ.pir

Procheck score ⇒ Ramachandran plot: 92.2% favored    3.9% allowed    3.1% week    .8% disallowed

Gene Informationback to top


Not Available

Gene Ontologyback to top


GO:0016021 - integral component of membrane

Family Classificationback to top


Pfam:   PF03083: MtN3_slv 

Interpro:   IPR004316: SWEET_sugar_transpr. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur