| Basic Information |
| Taxanomy |
| Sequence Information |
| Modeled Structures |
| Gene Information |
| Gene Ontology |
| Family Classification |
Details : V4V6C7
dbSWEET id: dbswt_712
Accession: V4V6C7
Uniprot status: Unreviewed
Organism: Citrus clementina
Kingdom: Plantae
Taxonomy back to top
Eukaryota ⇒ Viridiplantae ⇒ Streptophyta ⇒ Embryophyta ⇒ Tracheophyta ⇒ Spermatophyta ⇒ Magnoliophyta ⇒ eudicotyledons ⇒ Gunneridae ⇒ Pentapetalae ⇒ rosids ⇒ malvids ⇒ Sapindales ⇒ Rutaceae ⇒ Aurantioideae ⇒ Citrus.
Sequence Information back to top
Sequence length: 249
Substrate Binding Site: CNWN CVV: 441 CHI: -5.4
Selectivity Filter: LNMC CVV: 430 CHI: 4.7
Fasta sequence:
>tr|V4V6C7|V4V6C7_9ROSI|Unreviewed|Citrus_clementina|249
MDIAHFLFGVFGNATALFLFLAPTITFRRIVRRKSTEQFSGIPYVMTLLNCLLSAWYGLP
FVSKNNILVSTINGTGSAIEIIYVLIFLLFAPKKEKAKIFGLFMLVLTVFAAVALVSLLA
FHGNARKIFCGFAATIFSIIMYASPLSIMRMVIKTKSVEFMPFFLSLFVFLCGTSWFVFG
LLGRDPFVAVPNGFGCGLGTMQLILYFIYHKKGEPEKPSAANGSVEMGQEKPLEGTKMAN
GNGALVEQV
Snake diagram with key positions labelled

Modeled Structuresback to top
Model start: 1 Model end: 211
Alignment file: V4V6C7.pir
Inward Open:
Template: 5CTG.pdb
Model structure: V4V6C7_inward.pdb
Procheck score ⇒ Ramachandran plot: 94.0% favored 5.4% allowed .0% week .5% disallowed
Outward Open:
Template: 5CTG_outward.pdb
Model structure: V4V6C7_outward.pdb
Procheck score ⇒ Ramachandran plot: 95.7% favored 3.8% allowed .5% week .0% disallowed
Occluded:
Template: 5CTG_occluded.pdb
Model structure: V4V6C7_occluded.pdb
Procheck score ⇒ Ramachandran plot: 94.6% favored 4.9% allowed .5% week .0% disallowed
Gene Informationback to top
Gene ID: 18040441 Total Exons: 5 Coding Exons: 4
The diagram below shows the position of Exon-junctions in the protein structure ( Loops and transmembrane helices ).
If more than 1 exon translates a single secondary-structure , only the final exon is represented in figure.
Point on the red bars to view exon number






Gene Ontologyback to top
GO:0016021 - integral component of membrane
GO:0005886 - plasma membrane
GO:0008643 - carbohydrate transport
Family Classificationback to top
Pfam: PF03083: MtN3_slv.
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA